EVVYRRPEARDGTRVWELIRDTGSLDLNSPYCYMLLGDYFNDTCMIAEHEGDIVGFISAFRSPRNPETLFVWQVAVASSH
RRQGIAKAMLTGLMNQKACHGVRFIETTVSPSNMASRRLFLGYAEEKSIPSTVTVGYGAEMFPDGTTHEDEPLFVIGPFF
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sjy:B | 175 | 160 | 1.0000 | 0.9143 | 1.0000 | 2.04e-120 | 6sjy:A, 6sjy:C, 6sk1:A, 6sl8:A, 6sll:A, 6sll:B |
2 | 3d3s:A | 159 | 156 | 0.4125 | 0.4151 | 0.4231 | 8.70e-36 | 3d3s:C, 3d3s:D, 3d3s:B |
3 | 5hmn:B | 159 | 75 | 0.1500 | 0.1509 | 0.3200 | 1.42e-05 | 5hmn:A, 5hmn:C, 5hmn:E, 5hmn:F |
4 | 6bvc:A | 154 | 76 | 0.1437 | 0.1494 | 0.3026 | 0.001 | 1bo4:A, 1bo4:B |
5 | 5xxr:A | 123 | 61 | 0.1250 | 0.1626 | 0.3279 | 0.063 | 5xxr:B, 5xxs:A, 5xxs:B |
6 | 4jwp:A | 165 | 78 | 0.1437 | 0.1394 | 0.2949 | 0.13 | |
7 | 6c95:B | 160 | 84 | 0.1625 | 0.1625 | 0.3095 | 0.13 | 6ppl:C, 6pw9:C |
8 | 1nbh:A | 292 | 36 | 0.0875 | 0.0479 | 0.3889 | 0.15 | 1d2h:A, 1d2h:B, 1d2h:C, 1d2h:D, 2idk:B, 2idk:C, 2idk:D, 2idk:A, 1kia:A, 1kia:B, 1kia:C, 1kia:D, 1nbh:B, 1nbh:C, 1nbh:D, 1nbi:A, 1nbi:B, 1nbi:C, 1nbi:D, 3thr:A, 3thr:B, 3thr:C, 3thr:D, 3ths:B, 3ths:C, 3ths:D, 3ths:A, 1xva:A, 1xva:B |
9 | 4qb9:A | 402 | 44 | 0.1062 | 0.0423 | 0.3864 | 0.24 | 4qb9:B, 4qb9:C, 4qb9:D, 4qb9:E, 4qb9:F, 3sxn:A, 3sxn:B, 3sxn:C, 3sxn:D, 3sxn:E, 3sxn:F |
10 | 5k18:B | 179 | 79 | 0.1500 | 0.1341 | 0.3038 | 0.36 | 5k04:B, 5k18:D |
11 | 2cnm:A | 151 | 91 | 0.1562 | 0.1656 | 0.2747 | 0.41 | 2cnm:B, 2cnm:C, 2cns:A, 2cns:B, 2cns:C, 2cnt:A, 2cnt:B, 2cnt:C, 2cnt:D |
12 | 1s5k:A | 153 | 64 | 0.1000 | 0.1046 | 0.2500 | 0.51 | 1s3z:A, 1s3z:B, 1s5k:B, 1s60:A, 2vbq:A, 2vbq:B |
13 | 5jph:B | 144 | 58 | 0.1062 | 0.1181 | 0.2931 | 0.70 | 5jph:A, 5jph:C |
14 | 1x87:A | 495 | 99 | 0.1750 | 0.0566 | 0.2828 | 1.4 | 1x87:B |
15 | 6xru:A | 309 | 35 | 0.0750 | 0.0388 | 0.3429 | 1.9 | 5cae:A, 1euc:A, 2fpg:A, 7msr:A, 7mss:A, 7mst:A, 6wcv:A, 4xx0:A |
16 | 4kq6:D | 165 | 47 | 0.0938 | 0.0909 | 0.3191 | 2.0 | 4kq6:C, 4kq6:I, 4kq6:J |
17 | 7ovv:B | 196 | 101 | 0.1437 | 0.1173 | 0.2277 | 2.0 | 7ovv:A |
18 | 6wqc:A | 293 | 82 | 0.1375 | 0.0751 | 0.2683 | 2.4 | 6wqb:A |
19 | 3ld2:B | 162 | 58 | 0.0938 | 0.0926 | 0.2586 | 3.3 | 3ld2:A, 3ld2:C, 3ld2:D |
20 | 6th0:A | 176 | 74 | 0.1062 | 0.0966 | 0.2297 | 4.3 | 6tgx:A, 6tgx:B, 6th0:B |
21 | 8c7u:D | 262 | 47 | 0.0813 | 0.0496 | 0.2766 | 5.8 | 8c7u:A, 8c7u:B, 8c7u:C |
22 | 6b3t:A | 396 | 28 | 0.0813 | 0.0328 | 0.4643 | 7.3 | 6b0u:A, 6b0u:B, 6b0u:C, 8d1r:A, 8d23:A, 8d25:A, 5ebv:A, 5ec4:A, 8f4a:A, 8f4t:A, 8f4u:A, 8f4w:A, 8f4z:A, 8f51:A, 8f55:A, 8f57:A, 8f58:A, 5iv0:A, 4jd6:A, 4jd6:B, 4jd6:C, 4jd6:D, 4jd6:E, 4jd6:F, 6p3t:A, 6p3u:A, 6p3v:A, 3r1k:A, 3ryo:A, 3ryo:B, 3ryo:C, 3ryo:D, 3ryo:E, 3ryo:F, 3ryo:G, 3ryo:H, 3ryo:I, 3ryo:J, 3ryo:K, 3ryo:L, 5tvj:A, 6vur:A, 6vus:A, 6vut:A, 6vuu:A, 6vuw:A, 6vux:A, 6vuy:A, 6vuz:A, 6vv0:A, 6vv1:A, 6vv2:A, 6vv3:A, 6x10:A, 6x6g:AAA, 6x6i:AAA, 6x6y:AAA, 6x7a:AAA |
23 | 4jxr:B | 185 | 76 | 0.1250 | 0.1081 | 0.2632 | 8.1 | |
24 | 2obx:A | 150 | 34 | 0.0625 | 0.0667 | 0.2941 | 8.5 | 2obx:E, 2obx:B, 2obx:C, 2obx:D, 2obx:F, 2obx:J, 2obx:G, 2obx:H, 2obx:I |
25 | 7y12:R | 264 | 45 | 0.0750 | 0.0455 | 0.2667 | 9.8 | 7y14:R |