BioLiP

>protein
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIG
EMSFLQHNKCECRPKK

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1kat:V	99	96	1.0000	0.9697	1.0000	1.81e-68	6d3o:A, 6d3o:B, 4glu:D, 1kat:W, 4kzn:A, 3qtk:A, 3qtk:D, 3qtk:F, 6v7k:B, 1vpp:V, 1vpp:W, 6z13:W, 6z3f:W, 6zbr:W, 6zcd:W
2	4hqu:A	95	63	0.1875	0.1895	0.2857	3.24e-05	4hqx:A
3	5hb0:D	502	33	0.1250	0.0239	0.3636	1.6
4	7tbj:A2	1269	33	0.1250	0.0095	0.3636	1.7	7tbj:A4, 7tbk:A2, 7tbk:A4, 7tbl:A2, 7tbl:A4, 7tbm:A2, 7tbm:A4
5	7tbj:A5	1276	33	0.1250	0.0094	0.3636	1.7	5hax:A, 5hb0:B, 5hb0:C, 5hb0:A, 7tbi:A1, 7tbi:A2, 7tbi:A3, 7tbi:A4, 7tbj:A1, 7tbj:A3, 7tbj:A6, 7tbk:A1, 7tbk:A3, 7tbk:A5, 7tbk:A6, 7tbl:A1, 7tbl:A3, 7tbl:A5, 7tbl:A6, 7tbm:A1, 7tbm:A3, 7tbm:A5, 7tbm:A6
6	6awr:A	156	66	0.1667	0.1026	0.2424	2.4	6awr:B, 6aws:A, 6aws:C, 6awt:A, 6awt:B, 6awt:C, 6awt:D, 6awu:A, 6awu:B, 6awu:C, 6awu:D, 6awv:A, 6awv:B, 6awv:C, 6aww:B, 6aww:E, 6aww:D, 6aww:C, 6ax0:A, 6ax0:B, 6b1d:A, 6b1d:C, 4ma6:A
7	7pkt:r	158	32	0.1042	0.0633	0.3125	2.5
8	7tbu:A	450	60	0.1875	0.0400	0.3000	2.8	7tbu:B
9	5ech:A	569	35	0.1146	0.0193	0.3143	6.0	5ech:D, 5eci:A, 5eci:D, 5eck:A, 5eck:D, 5ecl:A, 5ecl:D, 5ecm:A, 5ecm:D, 5ecn:A, 5ecn:D, 5eco:A, 5eco:D, 5ecp:A, 5ecp:D, 5ecq:A, 5ecq:D, 5ecr:A, 5ecr:D, 4epl:A, 5gzz:A
10	3feu:A	183	45	0.1458	0.0765	0.3111	6.8
11	8hy9:A	159	38	0.1250	0.0755	0.3158	7.8
12	5k1b:A	264	34	0.1146	0.0417	0.3235	8.3
13	8g04:B	398	43	0.1250	0.0302	0.2791	8.5	8g04:C
14	5lva:A	174	15	0.1042	0.0575	0.6667	8.7	5lva:B

[Back]