EVVKFMDVYQRSYCHPIETLVDIFIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQ
HNKCECRPKK
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1kat:V | 99 | 96 | 1.0000 | 0.9091 | 0.9375 | 3.66e-61 | 6d3o:A, 6d3o:B, 4glu:D, 1kat:W, 4kzn:A, 3qtk:A, 3qtk:D, 3qtk:F, 6v7k:B, 1vpp:V, 1vpp:W, 6z13:W, 6z3f:W, 6zbr:W, 6zcd:W |
2 | 4hqu:A | 95 | 63 | 0.2000 | 0.1895 | 0.2857 | 2.67e-05 | 4hqx:A |
3 | 8hy9:A | 159 | 48 | 0.1667 | 0.0943 | 0.3125 | 0.049 | |
4 | 7pkt:r | 158 | 32 | 0.1111 | 0.0633 | 0.3125 | 2.2 | |
5 | 6awr:A | 156 | 42 | 0.1333 | 0.0769 | 0.2857 | 2.5 | 6awr:B, 6aws:A, 6aws:C, 6awt:A, 6awt:B, 6awt:C, 6awt:D, 6awu:A, 6awu:B, 6awu:C, 6awu:D, 6awv:A, 6awv:B, 6awv:C, 6aww:B, 6aww:E, 6aww:D, 6aww:C, 6ax0:A, 6ax0:B, 6b1d:A, 6b1d:C, 4ma6:A |
6 | 8g04:B | 398 | 43 | 0.1333 | 0.0302 | 0.2791 | 5.5 | 8g04:C |
7 | 2fge:A | 979 | 34 | 0.1111 | 0.0102 | 0.2941 | 5.8 | 2fge:B |
8 | 3feu:A | 183 | 42 | 0.1444 | 0.0710 | 0.3095 | 9.4 |