EVSAILVLTSSEASTLERVADLVTAHALYAAHDFCAQAQLAAAELPSRVVARLQEFAWGDMNEGHLLIKGLPQVRSLPPT
PTSNVHAVAATTPMSRYQALINECVGRMIAYEAEGHGHTFQDMVPSAMSAHSQTSLGSAVELELHTEQAFSPLRPDFVSL
ACLRGDPRALTYLFSARQLVATLTTQEIAMLREPMWTTTVDESFLAEGRTFLLGFERGPIPILSGADDDPFIVFDQDLMR
GISAPAQELQQTVIRAYYAERVSHCLAPGEMLLIDNRRAVHGRSIFAPRFDGADRFLSRSFIVADGSRSRHARSSFGRVV
SARFS
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6f2a:C | 326 | 325 | 1.0000 | 0.9969 | 1.0000 | 0.0 | 6f2a:A, 6f2a:B, 6f2a:D, 6f2b:A, 6f2b:B, 6f2b:C, 6f2b:D, 6f6j:A, 6f6j:B, 6f6j:C, 6f6j:D |
2 | 2og6:A | 323 | 323 | 0.3231 | 0.3251 | 0.3251 | 8.13e-37 | 2og7:A |
3 | 1ds1:A | 323 | 304 | 0.2954 | 0.2972 | 0.3158 | 2.27e-28 | 1drt:A, 1dry:A, 1gvg:A |
4 | 6vwq:A | 325 | 299 | 0.2769 | 0.2769 | 0.3010 | 1.40e-27 | 6vwr:A |
5 | 6daw:A | 342 | 339 | 0.2769 | 0.2632 | 0.2655 | 2.91e-24 | 6daw:B |
6 | 6alm:A | 338 | 322 | 0.3046 | 0.2929 | 0.3075 | 4.07e-24 | 6aln:A, 6alo:A, 6alp:A, 6alq:A, 6alr:A, 6dax:A, 6daz:A, 6db2:A, 9eqf:A, 6mp9:A, 2wbo:A, 2wbp:A, 2wbq:A, 6y0n:A, 6y12:A |
7 | 4ne0:A | 337 | 332 | 0.3015 | 0.2908 | 0.2952 | 1.58e-23 | 4m25:A, 4m26:A, 4m26:C, 4m26:D, 4m27:A, 4m27:C, 4m27:D, 4m2c:B, 4m2c:C, 4m2c:D, 4m2e:B, 4m2e:C, 4m2e:D, 4m2f:A, 4m2f:C, 4m2f:D, 4m2g:A, 4m2g:C, 4m2g:D, 4m2i:A, 4ne0:C |
8 | 4m25:B | 317 | 319 | 0.2954 | 0.3028 | 0.3009 | 2.12e-23 | 4m25:C, 4m25:D, 4m26:B, 4m27:B, 4m2f:B, 4m2g:B, 4m2i:B, 4m2i:C, 4m2i:D, 4ne0:B, 4ne0:D |
9 | 6mp8:A | 308 | 301 | 0.2862 | 0.3019 | 0.3090 | 1.45e-22 | |
10 | 7y5f:B | 341 | 285 | 0.2738 | 0.2610 | 0.3123 | 3.72e-18 | 7vgn:A, 7y5f:A, 7y5i:A, 7y5i:B, 7y5p:A, 7y5p:B, 7yhe:A, 7yhe:B, 7yw9:A |
11 | 6euo:C | 354 | 297 | 0.2215 | 0.2034 | 0.2424 | 1.15e-11 | 6euo:A, 6euo:B, 6euo:D, 6eur:A, 6eur:C, 6eur:D, 6exf:A, 6exf:C, 6exf:D, 6exh:A, 6exh:B, 6exh:C, 6exh:D, 6f9p:A, 6f9p:C, 6f9p:D |
12 | 6eur:B | 328 | 301 | 0.2185 | 0.2165 | 0.2359 | 7.30e-10 | 6exf:B |
13 | 7tcl:X | 259 | 176 | 0.1169 | 0.1467 | 0.2159 | 0.002 | |
14 | 6f9p:B | 289 | 303 | 0.2154 | 0.2422 | 0.2310 | 0.005 | |
15 | 3aer:D | 421 | 84 | 0.0585 | 0.0451 | 0.2262 | 0.35 | 3aek:B, 3aek:D, 3aeq:B, 3aeq:D, 3aer:B, 3aes:B, 3aes:D, 3aet:B, 3aet:D, 3aeu:D |
16 | 1nx4:C | 250 | 32 | 0.0400 | 0.0520 | 0.4062 | 0.94 | 1nx4:A, 1nx8:A, 1nx8:C |
17 | 2wjy:A | 773 | 82 | 0.0585 | 0.0246 | 0.2317 | 1.0 | 2gjk:A, 2gk6:A, 2gk6:B, 2gk7:A, 8rxb:E, 8rxb:A, 8rxb:D, 8rxb:I, 8rxb:L, 8rxb:P, 2wjv:A, 2wjv:B, 2xzo:A |
18 | 4oj8:B | 271 | 32 | 0.0400 | 0.0480 | 0.4062 | 1.2 | 1nx4:B, 1nx8:B, 4oj8:A, 4oj8:C |
19 | 6ujd:A | 406 | 63 | 0.0554 | 0.0443 | 0.2857 | 2.0 | |
20 | 6npb:B | 378 | 77 | 0.0677 | 0.0582 | 0.2857 | 2.6 | 6npb:A, 6npc:A, 6npc:B, 6npd:A, 6npd:B |
21 | 7wkv:A | 219 | 39 | 0.0431 | 0.0639 | 0.3590 | 7.6 | 4nj4:A, 4nj4:B, 4nro:A, 4nrp:A, 4nrq:A, 4o7x:A, 4oct:A, 4oct:B, 7v4g:A, 7v4g:B, 7v4g:C, 7wkv:C, 7wkv:E, 7wl0:A, 7wl0:C, 7wl0:E, 7wl0:G, 7wl0:I |