BioLiP

>protein
EVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIP
HEYDLELTKKVVENEYVFTEQNLKKYQRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKE
RITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLK
ECLDKVATLVKYTLRPEYKKL

The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8cen:R	268	268	1.0000	0.9739	0.9739	0.0	8ceo:R, 7o4i:R, 7o4j:R, 7o72:R, 7o73:R, 7o75:R, 7zs9:R, 7zsa:R, 7zsb:R
2	5fmf:V	174	121	0.4023	0.6034	0.8678	1.67e-68
3	5fmf:V	174	68	0.2337	0.3506	0.8971	3.12e-34
4	6o9l:T	237	232	0.2184	0.2405	0.2457	3.52e-14	8bvw:R, 8byq:R, 8bz1:R, 7eg8:T, 7ega:T, 7egb:T, 7egc:T, 7ena:FB, 7enc:FB, 8gxq:FB, 8gxs:FB, 5iy6:T, 5iy7:T, 5iy8:T, 5iy9:T, 5iya:T, 5iyb:T, 5iyc:T, 5iyd:T, 7lbm:T, 7nvr:R, 7nvs:R, 7nvt:R, 7nvu:R, 7nvy:R, 7nvz:R, 7nw0:R, 8s51:R, 8s52:R, 8s5n:R, 8wak:T, 8wal:T, 8wan:T, 8wao:T, 8wap:T, 8waq:T, 8war:T, 8was:T, 7zwd:R, 7zx7:R, 7zx8:R
5	3c51:B	461	108	0.1149	0.0651	0.2778	1.3
6	7kct:A	453	42	0.0536	0.0309	0.3333	4.2	7kbl:A, 7kbl:B, 7kc7:A, 7kct:B
7	7jjn:A	514	22	0.0421	0.0214	0.5000	7.7	7jjn:B

[Back]