EVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIP
HEYDLELTKKVVENEYVFTEQNLKKYQRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKE
RITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLK
ECLDKVATLVKYTLRPEYKKL
The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8cen:R | 268 | 268 | 1.0000 | 0.9739 | 0.9739 | 0.0 | 8ceo:R, 7o4i:R, 7o4j:R, 7o72:R, 7o73:R, 7o75:R, 7zs9:R, 7zsa:R, 7zsb:R |
2 | 5fmf:V | 174 | 121 | 0.4023 | 0.6034 | 0.8678 | 1.67e-68 | |
3 | 5fmf:V | 174 | 68 | 0.2337 | 0.3506 | 0.8971 | 3.12e-34 | |
4 | 6o9l:T | 237 | 232 | 0.2184 | 0.2405 | 0.2457 | 3.52e-14 | 8bvw:R, 8byq:R, 8bz1:R, 7eg8:T, 7ega:T, 7egb:T, 7egc:T, 7ena:FB, 7enc:FB, 8gxq:FB, 8gxs:FB, 5iy6:T, 5iy7:T, 5iy8:T, 5iy9:T, 5iya:T, 5iyb:T, 5iyc:T, 5iyd:T, 7lbm:T, 7nvr:R, 7nvs:R, 7nvt:R, 7nvu:R, 7nvy:R, 7nvz:R, 7nw0:R, 8s51:R, 8s52:R, 8s5n:R, 8wak:T, 8wal:T, 8wan:T, 8wao:T, 8wap:T, 8waq:T, 8war:T, 8was:T, 7zwd:R, 7zx7:R, 7zx8:R |
5 | 3c51:B | 461 | 108 | 0.1149 | 0.0651 | 0.2778 | 1.3 | |
6 | 7kct:A | 453 | 42 | 0.0536 | 0.0309 | 0.3333 | 4.2 | 7kbl:A, 7kbl:B, 7kc7:A, 7kct:B |
7 | 7jjn:A | 514 | 22 | 0.0421 | 0.0214 | 0.5000 | 7.7 | 7jjn:B |