ETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGSDDWSEEP
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1lv3:A | 65 | 61 | 1.0000 | 0.8769 | 0.9344 | 2.19e-35 | 4tma:I, 4tma:J, 4tma:L |
2 | 6nr1:A | 279 | 25 | 0.2105 | 0.0430 | 0.4800 | 0.63 | 6nr1:B |
3 | 5k2m:F | 53 | 56 | 0.2807 | 0.3019 | 0.2857 | 0.88 | 5k2m:E |
4 | 3dzv:A | 265 | 30 | 0.2281 | 0.0491 | 0.4333 | 2.6 | 3dzv:B |
5 | 7sa4:8 | 203 | 34 | 0.1930 | 0.0542 | 0.3235 | 4.6 | |
6 | 5xyi:a | 100 | 22 | 0.1754 | 0.1000 | 0.4545 | 4.7 | |
7 | 3d3w:A | 244 | 20 | 0.1579 | 0.0369 | 0.4500 | 6.3 | 3d3w:B, 1pr9:A, 1pr9:B, 1wnt:A, 1wnt:B, 1wnt:C, 1wnt:D |
8 | 3ven:A | 571 | 19 | 0.1579 | 0.0158 | 0.4737 | 9.7 | 3veo:A, 3ver:A, 3ves:A, 3vet:A, 3vew:A, 3vex:A, 3vez:A, 3vf2:A, 3vf4:A |
9 | 2f0c:B | 148 | 32 | 0.2456 | 0.0946 | 0.4375 | 9.7 | 2f0c:A, 2f0c:C |