ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2p6a:C | 282 | 73 | 0.9178 | 0.2376 | 0.9178 | 4.78e-38 | 1lr7:A, 1lr8:A |
2 | 2p6a:C | 282 | 74 | 0.3836 | 0.0993 | 0.3784 | 5.88e-06 | 1lr7:A, 1lr8:A |
3 | 2p6a:C | 282 | 73 | 0.3425 | 0.0887 | 0.3425 | 2.84e-05 | 1lr7:A, 1lr8:A |
4 | 7kbu:A | 221 | 80 | 0.3425 | 0.1131 | 0.3125 | 5.65e-06 | 7kbu:B |
5 | 1bmo:A | 233 | 79 | 0.3562 | 0.1116 | 0.3291 | 4.91e-05 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
6 | 3poy:A | 1005 | 45 | 0.1918 | 0.0139 | 0.3111 | 1.9 | 3asi:A, 3b3q:E, 3b3q:F, 3biw:E, 3biw:F, 3biw:G, 3bod:A, 2h0b:A, 2h0b:B, 2h0b:C, 2h0b:D, 2r16:A, 2r1d:H, 2r1d:B, 2r1d:D, 2r1d:I, 3vkf:C, 3vkf:D, 2wqz:C, 2wqz:D, 2xb6:C, 2xb6:D, 5z8y:B, 5z8y:D, 5z8y:F, 5z8y:H |
7 | 4adg:C | 432 | 51 | 0.1781 | 0.0301 | 0.2549 | 5.5 | 4adg:A, 4adg:B, 4adj:A, 4adj:B, 4adj:C, 4b3v:A, 4b3v:B, 4b3v:C |
8 | 8fkp:NE | 156 | 38 | 0.1918 | 0.0897 | 0.3684 | 7.6 | 8fkq:NE, 8fkr:NE, 8fks:NE |