ESPERGRKRLGIYLAHFLDHVEGHMGEIGVQRDALAEDARLGALIDRALADMAVARASLNAVLRDL
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hk5:B | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 2.81e-41 | 6hk5:C, 6hk5:E, 6hk5:G, 6hk5:A, 6hk5:D, 6hk5:F, 6hk5:H |
2 | 8unx:A | 244 | 58 | 0.2879 | 0.0779 | 0.3276 | 1.2 | 7f1o:A, 7f1z:A, 7f23:A, 7f24:A, 5g53:C, 8gfv:A, 8gfw:A, 8gfx:A, 8gfy:A, 8gfz:A, 8gg0:A, 8gg1:A, 8gg2:A, 8gg3:A, 8gg4:A, 8gg5:A, 8gg6:A, 8gg7:A, 8gg8:A, 8gw8:A, 8jr9:A, 8unl:A, 8unm:A, 8unn:A, 8uno:A, 8unp:A, 8unq:A, 8unr:A, 8uns:A, 8unt:A, 8unu:A, 8unv:A, 8unw:A, 8uny:A, 8unz:A, 8uo0:A, 7vui:A, 7vuj:A |
3 | 5b16:A | 722 | 56 | 0.2727 | 0.0249 | 0.3214 | 6.6 | |
4 | 6lxe:A | 768 | 56 | 0.2727 | 0.0234 | 0.3214 | 7.6 | |
5 | 6lxd:A | 918 | 56 | 0.2727 | 0.0196 | 0.3214 | 7.7 | 9asm:A, 9asn:A, 9aso:A, 9asp:A, 9asq:A, 6v5b:A, 6v5c:A |
6 | 8p8k:AAA | 276 | 23 | 0.1515 | 0.0362 | 0.4348 | 9.4 | 8p8k:BBB, 8qrt:AAA, 8qrt:BBB, 8qrt:CCC, 8qrt:DDD, 8qs0:AAA, 8qs0:BBB, 8qs0:CCC, 8qs0:DDD |
7 | 3gaz:A | 331 | 55 | 0.2576 | 0.0514 | 0.3091 | 10.0 | 3gaz:B |