BioLiP

>protein
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3clc:B	77	76	0.9868	0.9740	0.9868	8.82e-48	3clc:A, 3clc:C, 3clc:D, 4i8t:A, 4ivz:A, 4ivz:B, 4ivz:E, 4ivz:F, 4iwr:A, 4iwr:B, 4iwr:E, 4iwr:F, 3s8q:A, 3s8q:B, 3ufd:A, 3ufd:B, 3ufd:E, 3ufd:F, 4x4b:A, 4x4b:B, 4x4b:C, 4x4b:D, 4x4c:A, 4x4c:B, 4x4c:C, 4x4c:D, 4x4d:A, 4x4d:B, 4x4d:C, 4x4d:D, 4x4e:A, 4x4e:B, 4x4e:C, 4x4e:D, 4x4f:A, 4x4f:B, 4x4f:C, 4x4f:D, 4x4g:A, 4x4g:B, 4x4g:C, 4x4g:D, 4x4h:A, 4x4h:B, 4x4h:C, 4x4h:D, 4x4i:A, 4x4i:B, 4x4i:C, 4x4i:D
2	1b0n:A	103	52	0.2763	0.2039	0.4038	3.71e-04	3zkc:A, 3zkc:B
3	1y9q:A	178	62	0.2368	0.1011	0.2903	0.003
4	4ryk:A	295	58	0.2632	0.0678	0.3448	0.005
5	2qfc:A	284	60	0.2500	0.0669	0.3167	0.079	2qfc:B, 3u3w:A, 3u3w:B
6	2xiu:A	66	46	0.2368	0.2727	0.3913	0.27
7	7o81:AU	110	34	0.1974	0.1364	0.4412	0.76	6zvh:i
8	7nrd:Sh	120	38	0.1842	0.1167	0.3684	2.3	6zvi:T
9	1v9l:A	418	36	0.1579	0.0287	0.3333	3.6	1v9l:B, 1v9l:C, 1v9l:D, 1v9l:E, 1v9l:F
10	6rtg:A	503	69	0.2895	0.0437	0.3188	3.7
11	1pvw:A	219	66	0.2500	0.0868	0.2879	4.5	1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B
12	4ij6:A	207	53	0.1842	0.0676	0.2642	7.2	4ij6:B

[Back]