ESFAFGAVVERRDELDGRPWISYPVRVVADTPELVAVHLSHGTRLTFGDDPFSWGPHPWQLFGDRWQSAGILQLHRPGRG
HSVWVLRDADTGAFREWYVNVEAPWRRTPTGFSTLDHEIDLVVPADSRTFRWKDVEKFEERARIGHFSPEEATAIRAEAA
DVAREIAAGEQWWDTRWSRWEPPAGWNALLQSFETEGS
The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5zdm:A | 198 | 198 | 1.0000 | 1.0000 | 1.0000 | 2.10e-142 | 5zdn:A |
2 | 3cbt:A | 210 | 176 | 0.2929 | 0.2762 | 0.3295 | 7.36e-16 | 3exm:A |
3 | 8hl1:AEFG | 725 | 25 | 0.0556 | 0.0152 | 0.4400 | 4.0 | 8hl2:AEFG, 8hl3:AEFG, 8hl4:AEFG |
4 | 8q7h:A | 1403 | 33 | 0.0606 | 0.0086 | 0.3636 | 5.1 |