ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFL
PEAKR
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1e91:A | 85 | 85 | 1.0000 | 1.0000 | 1.0000 | 3.08e-59 | 1pd7:A |
| 2 | 1g1e:B | 89 | 82 | 0.6118 | 0.5843 | 0.6341 | 9.87e-32 | 1s5q:B, 1s5r:B |
| 3 | 6xdj:A | 441 | 77 | 0.4941 | 0.0952 | 0.5455 | 1.93e-20 | 6xaw:A, 6xdj:B |
| 4 | 5y95:A | 80 | 82 | 0.2941 | 0.3125 | 0.3049 | 4.08e-09 | |
| 5 | 2czy:A | 77 | 81 | 0.2941 | 0.3247 | 0.3086 | 1.76e-08 | |
| 6 | 7wjl:A | 453 | 48 | 0.1882 | 0.0353 | 0.3333 | 1.1 | |
| 7 | 2i13:A | 151 | 59 | 0.1765 | 0.0993 | 0.2542 | 1.2 | |
| 8 | 2i13:B | 144 | 59 | 0.1765 | 0.1042 | 0.2542 | 1.4 | |
| 9 | 2i13:B | 144 | 45 | 0.1412 | 0.0833 | 0.2667 | 7.2 | |
| 10 | 7xhn:K | 230 | 63 | 0.2353 | 0.0870 | 0.3175 | 2.0 | 7xho:K |
| 11 | 7sss:F | 173 | 40 | 0.1529 | 0.0751 | 0.3250 | 4.4 | 7sss:E, 7sss:H, 7sss:G |
| 12 | 8qoy:A | 1036 | 20 | 0.1059 | 0.0087 | 0.4500 | 5.7 | |
| 13 | 8a3y:A | 1426 | 49 | 0.1647 | 0.0098 | 0.2857 | 6.3 | 8oeu:A, 8oev:A, 8oew:A, 8of0:A, 7okx:A, 7oky:A, 7ol0:A, 7pks:A, 8rbx:A, 6ted:A, 8uhg:A, 8ui0:A, 7unc:A, 7und:A |
| 14 | 6o9l:A | 1476 | 49 | 0.1647 | 0.0095 | 0.2857 | 7.1 | 8a40:A, 8bvw:A, 8byq:A, 8bz1:A, 7edx:o, 7eg7:o, 7eg8:o, 7eg9:o, 7ega:o, 7egb:o, 7egc:o, 6exv:A, 5flm:A, 5iy6:A, 5iy7:A, 5iy8:A, 5iy9:A, 5iya:A, 5iyb:A, 5iyc:A, 5iyd:A, 7nvr:A, 7nvs:A, 7nvt:A, 7nvu:A, 7nvy:A, 7nvz:A, 7nw0:A, 8s5n:A, 8wak:o, 8wal:o, 8wan:o, 8wao:o, 8wap:o, 8waq:o, 8war:o, 8was:o, 8wat:o, 8wau:o, 8wav:o, 8waw:o, 8wax:o, 8way:o, 8waz:o, 8wb0:o, 6xre:A, 7zwd:A, 7zx7:A, 7zx8:A |
| 15 | 7ena:PA | 1475 | 49 | 0.1647 | 0.0095 | 0.2857 | 7.3 | 7b0y:A, 8b3d:A, 8b3f:A, 7enc:PA, 6gmh:A, 6gml:A, 8gxq:PA, 8gxs:PA, 7lbm:A, 5oik:A, 7oo3:A, 7oob:A, 7oop:A, 7opc:A, 7opd:A, 8p4a:A, 8p4b:A, 8p4c:A, 8p4d:A, 8p4e:A, 8p4f:A, 8s51:A, 8s52:A, 8s54:A, 8s55:A, 8uha:A, 8uhd:A, 8uis:A, 8w8e:A, 8w8f:A, 7ycx:1 |
| 16 | 1s49:A | 588 | 49 | 0.2000 | 0.0289 | 0.3469 | 8.2 | |
| 17 | 7d5c:A | 919 | 30 | 0.1412 | 0.0131 | 0.4000 | 8.8 | |
| 18 | 3zq4:A | 550 | 26 | 0.1059 | 0.0164 | 0.3462 | 9.3 | 3zq4:C, 3zq4:D, 3zq4:E |
| 19 | 2epa:A | 72 | 36 | 0.0941 | 0.1111 | 0.2222 | 9.4 |
umich.edu