ERTSIAVHALMGLPTGQPANGTKLDSIGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATK
KTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALS
The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3htl:X | 422 | 143 | 0.9301 | 0.3152 | 0.9301 | 4.13e-90 | 3hr6:A, 7k7f:A |
2 | 4hss:A | 411 | 138 | 0.2797 | 0.0973 | 0.2899 | 1.73e-11 | 4hsq:A, 4hss:B |
3 | 3uxf:A | 449 | 110 | 0.2448 | 0.0780 | 0.3182 | 1.96e-07 | |
4 | 7qbz:A | 638 | 32 | 0.0979 | 0.0219 | 0.4375 | 0.19 | 7qc0:A |
5 | 5m45:B | 709 | 28 | 0.0909 | 0.0183 | 0.4643 | 0.94 | 5m45:E, 5m45:H, 5m45:K, 5svb:B, 5svb:E |
6 | 6ow0:A | 323 | 64 | 0.1608 | 0.0712 | 0.3594 | 3.5 | |
7 | 6ow0:B | 301 | 64 | 0.1608 | 0.0764 | 0.3594 | 4.1 | 6ovx:A, 6ovx:B |
8 | 7acs:A | 140 | 35 | 0.0839 | 0.0857 | 0.3429 | 4.9 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
9 | 6ut5:A | 395 | 17 | 0.0629 | 0.0228 | 0.5294 | 9.8 | 6ut3:C, 6ut3:D, 6ut3:E, 6ut3:F, 6ut4:A, 6ut4:B, 6ut4:C, 6ut4:D, 6ut4:E, 6ut4:F, 6ut5:B, 6ut5:C, 6ut5:D, 6ut5:E, 6ut5:F, 6ut7:A, 6ut7:B, 6ut7:C, 6ut7:D, 6ut7:E, 6ut7:F, 6ut7:H, 6ut7:I, 6ut7:J, 6ut7:K, 6ut7:L, 6ut7:M, 6ut8:A, 6ut8:B, 6ut8:C, 6ut8:D, 6ut8:E, 6ut8:F |