BioLiP

>protein
ERTFSEALKNRRTYYSITDQSPIPDQEIECIINLAVRHVPSAFNSQSTRVVLLLGKSHKKLWNIVKDALRKIVPGEAFAK
TEEKIDNSFACGYGTVLFFEDQKVVKGLQEAFPSYQENFPGWSLQTSAMHQLAVWVMLEDVGFGASLQHYNPLIDDEVRR
AWNLPAHWHLIAEMPFGVPVNKPGEKEFQPLEERIKVFK

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8cqv:A	202	199	1.0000	0.9851	1.0000	1.62e-150	8cqv:B
2	1ywq:A	199	195	0.4523	0.4523	0.4615	9.62e-62
3	2ifa:B	201	197	0.4221	0.4179	0.4264	1.54e-54	2ifa:A, 2ifa:C, 2ifa:D, 2ifa:E, 2ifa:F
4	4bn9:A	191	198	0.4372	0.4555	0.4394	9.99e-49	4bn6:A, 4bn7:A, 4bn8:A, 4bnb:A, 2wqf:A
5	1zch:A	249	55	0.0905	0.0723	0.3273	0.17
6	3bem:B	210	74	0.1005	0.0952	0.2703	0.70	3bem:A
7	8dqd:A	370	68	0.1055	0.0568	0.3088	1.1	8dvw:A, 8dvz:A
8	3kwk:A	168	68	0.1055	0.1250	0.3088	2.5
9	8cqt:B	164	192	0.2060	0.2500	0.2135	3.9	8cqt:A
10	3qo8:A	441	50	0.0704	0.0317	0.2800	4.1	3qo7:A
11	2hdc:A	97	31	0.0553	0.1134	0.3548	4.6
12	3m5k:A	168	64	0.1005	0.1190	0.3125	6.2	3m5k:B
13	8avk:A	202	46	0.0603	0.0594	0.2609	7.3	8avk:B, 8avn:A, 8avn:B
14	4x6r:B	290	32	0.0553	0.0379	0.3438	7.7	3fhi:B, 4jv4:A, 5kjx:A, 5kjy:A, 5kjz:A, 7lz4:A, 7lz4:B, 7lz4:C, 7lz4:D, 7lz4:E, 7lz4:F, 7lz4:G, 7lz4:H, 4mx3:A, 4mx3:B, 1ne4:A, 1ne6:A, 3plq:A, 3pna:A, 3pna:B, 1rgs:A, 1rl3:A, 1rl3:B

[Back]