ERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCE
ALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDV
LTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELL
GTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
The query sequence (length=279) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ois:AB | 279 | 279 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7a5i:b6, 7a5k:b6, 8k2a:Sk, 7po2:1, 7qi4:A1, 7qi5:A1, 7qi6:A1, 8xt0:Sk, 8xt2:Sk |
2 | 3jd5:k | 275 | 274 | 0.8638 | 0.8764 | 0.8796 | 0.0 | 8oin:AB, 8oip:AB, 6ydw:Ak |
3 | 7pnt:1 | 278 | 278 | 0.8208 | 0.8237 | 0.8237 | 6.93e-177 | 7pnu:1 |
4 | 6xyw:Bz | 123 | 74 | 0.0896 | 0.2033 | 0.3378 | 1.59e-04 | |
5 | 8om2:Y | 272 | 105 | 0.1147 | 0.1176 | 0.3048 | 0.001 | 8d8k:Y, 8d8l:Y, 5mrc:YY, 5mre:YY, 5mrf:YY, 8om3:Y, 8om4:Y |
6 | 8v9k:z | 364 | 52 | 0.0645 | 0.0495 | 0.3462 | 2.6 | |
7 | 6uz7:AE | 164 | 109 | 0.1111 | 0.1890 | 0.2844 | 5.2 | 5it7:EE |
8 | 2etz:A | 108 | 52 | 0.0502 | 0.1296 | 0.2692 | 5.8 | 2eu0:A |
9 | 6xyw:At | 105 | 77 | 0.0753 | 0.2000 | 0.2727 | 6.5 | |
10 | 8dfv:A | 1664 | 69 | 0.0573 | 0.0096 | 0.2319 | 7.9 |