ERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCL
SVEAIESYVLGS
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7sfz:A | 100 | 100 | 1.0000 | 0.9200 | 0.9200 | 9.38e-60 | 7sfz:B, 7sfz:C, 7sfz:D, 7sfz:E, 7sfz:F, 7sfz:G |
2 | 7sfz:H | 84 | 90 | 0.9130 | 1.0000 | 0.9333 | 1.06e-51 | |
3 | 5j6p:B | 102 | 100 | 0.3913 | 0.3529 | 0.3600 | 4.58e-11 | 5hj0:A, 5hj0:B, 5hj0:C, 5j6p:A, 5j6p:C |
4 | 7w6m:A | 1224 | 48 | 0.1739 | 0.0131 | 0.3333 | 0.19 | 7w6m:C, 7w6m:B, 7w73:C, 7w73:A, 7y6t:B, 7y6u:A |
5 | 6u7k:A | 1064 | 48 | 0.1739 | 0.0150 | 0.3333 | 0.43 | |
6 | 4eie:A | 82 | 50 | 0.2283 | 0.2561 | 0.4200 | 0.92 | 4eif:A |
7 | 6z1p:BL | 181 | 64 | 0.2065 | 0.1050 | 0.2969 | 1.5 | |
8 | 6vv5:A | 1097 | 43 | 0.1630 | 0.0137 | 0.3488 | 2.2 | 6vv5:B, 6vv5:C |
9 | 5jio:A | 467 | 63 | 0.1957 | 0.0385 | 0.2857 | 2.3 | 5k41:A, 5k42:A, 5k44:A, 5k5c:A, 5l3k:A, 5l3k:B, 5l3k:C, 5l3k:D, 5l3k:E, 5l3k:F, 5l3k:G, 5l3k:H |
10 | 1wyh:A | 72 | 26 | 0.1413 | 0.1806 | 0.5000 | 2.6 | |
11 | 3adp:A | 310 | 17 | 0.0870 | 0.0258 | 0.4706 | 4.6 | |
12 | 7r81:L2 | 90 | 24 | 0.1087 | 0.1111 | 0.4167 | 5.3 | 7olc:SK, 7old:SK, 8oo0:SK, 7z3n:SK, 7z3o:SK |