ERKFCSFCKHNGETEAVYTSHYLKNRDGDVMCPYLRQYKCPLCGATGAKAHTKRFCPMVDKNYCS
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3alr:C | 67 | 65 | 1.0000 | 0.9701 | 1.0000 | 1.98e-45 | 3alr:A, 3alr:B, 3alr:D |
2 | 5kl1:B | 70 | 55 | 0.4154 | 0.3857 | 0.4909 | 2.56e-16 | 5kl8:B |
3 | 1kc7:A | 872 | 27 | 0.1692 | 0.0126 | 0.4074 | 0.89 | |
4 | 6zca:Y | 1127 | 23 | 0.1692 | 0.0098 | 0.4783 | 1.2 | 6zfb:Y, 6zfb:y |
5 | 8p5q:A | 129 | 38 | 0.1846 | 0.0930 | 0.3158 | 1.5 | |
6 | 6q63:A | 751 | 52 | 0.2769 | 0.0240 | 0.3462 | 1.7 | 6q63:B, 6q63:C |
7 | 5f3o:B | 189 | 43 | 0.1846 | 0.0635 | 0.2791 | 1.8 | |
8 | 1igy:B | 434 | 21 | 0.1538 | 0.0230 | 0.4762 | 4.2 | 1igy:D |
9 | 5e1q:B | 644 | 38 | 0.1846 | 0.0186 | 0.3158 | 6.1 | 3a24:A, 3a24:B, 5e1q:A |
10 | 2aus:D | 53 | 24 | 0.1538 | 0.1887 | 0.4167 | 6.7 | 2aus:B, 2ey4:E, 2ey4:F, 3hax:C, 3hay:C, 3hjw:B, 2hvy:C, 3lwo:B, 3lwp:B, 3lwq:B, 3lwr:B, 3lwv:B, 2rfk:B |
11 | 1ffk:W | 73 | 22 | 0.1385 | 0.1233 | 0.4091 | 6.9 | |
12 | 5vcm:B | 358 | 27 | 0.1385 | 0.0251 | 0.3333 | 10.0 | 5vcm:A, 5vcs:A |