BioLiP

>protein
ERILKKQPAPVRALTIHPLRRYESSIYDTPIPAYVIKHSSDGVTIDIATSELADGQSGSTIQPFESVPAQNLTLFKHDFT
FGHLADTTDKKFVEVFGVLENRADDSDFQSPDMIIETETGHVYVVEFTTTMGDANSADLAARNKIAKYEIACLDRSAIKP
ISLYIIAVHFNGVVSNLDLSDEEVNEIVFRFRLARDIFEELRE

The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6qw5:A	204	203	1.0000	0.9951	1.0000	1.63e-150	6qvv:A, 6qvv:B, 6qw0:A, 6qw0:B, 6qw5:B
2	8r6y:A	1991	184	0.3054	0.0311	0.3370	2.39e-18	8as7:A, 8r6w:A, 6xya:B
3	7alp:U	1935	183	0.2906	0.0305	0.3224	6.75e-18
4	8asd:A	1826	183	0.3005	0.0334	0.3333	9.57e-18
5	8asb:A	1715	183	0.3005	0.0356	0.3333	1.05e-17	8as6:A, 8asg:A, 8r6u:A
6	6eoa:A	193	68	0.1084	0.1140	0.3235	0.20
7	7zpk:C	233	59	0.0837	0.0730	0.2881	0.84	3adl:A, 5n8l:A, 5n8m:A
8	7uab:A	481	38	0.0640	0.0270	0.3421	2.2	7uab:D
9	5zho:A	162	56	0.0887	0.1111	0.3214	2.3
10	5c2v:D	770	58	0.0887	0.0234	0.3103	2.5	5c2v:A, 5c2w:A, 5c2w:D
11	8jwf:A	1204	69	0.0985	0.0166	0.2899	3.6	8jwg:A, 8jwi:A
12	8f5o:C	1179	20	0.0493	0.0085	0.5000	8.4	8f5p:C
13	1s49:A	588	61	0.0837	0.0289	0.2787	8.6
14	3tts:A	675	43	0.0542	0.0163	0.2558	8.8	3tts:B, 3tts:C, 3tts:D, 3tts:E, 3tts:F, 3tty:A, 3tty:B, 3tty:C, 3tty:D, 3tty:E, 3tty:F

[Back]