ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVH
NVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4edn:A | 127 | 127 | 1.0000 | 1.0000 | 1.0000 | 5.22e-89 | 4edn:B, 4edn:C, 4edn:D, 4edn:E, 4edn:F, 4edn:G |
2 | 2k2r:A | 129 | 127 | 0.8898 | 0.8760 | 0.8898 | 4.06e-79 | 2vzd:A, 2vzd:B, 2vzg:B, 2vzi:B |
3 | 2wa5:A | 237 | 116 | 0.2205 | 0.1181 | 0.2414 | 3.07e-04 | 2wa7:A |
4 | 6sl2:A | 619 | 103 | 0.1890 | 0.0388 | 0.2330 | 0.005 | 5nl7:A, 6sl3:A |
5 | 4q57:B | 244 | 107 | 0.2126 | 0.1107 | 0.2523 | 0.006 | |
6 | 5f23:A | 263 | 44 | 0.1181 | 0.0570 | 0.3409 | 1.6 | |
7 | 5bvr:A | 229 | 108 | 0.2047 | 0.1135 | 0.2407 | 1.8 | |
8 | 7aq4:B | 588 | 92 | 0.2126 | 0.0459 | 0.2935 | 3.3 | 7apy:A, 7apy:B, 7aq0:A, 7aq0:B, 7aq2:A, 7aq2:B, 7aq3:A, 7aq3:B, 7aq4:A, 7aq5:A, 7aq5:B, 7aq6:A, 7aq6:B, 7aq7:A, 7aq7:B, 7aq8:A, 7aq8:B, 7aq9:A, 7aq9:B, 7aqa:A, 7aqa:B, 7qba:H, 7qba:I, 6rkz:A, 6rkz:B, 6rl0:A, 6rl0:B, 6rl0:C, 6rl0:D, 3sbp:A, 3sbp:B, 3sbp:C, 3sbp:D, 3sbp:E, 3sbp:F, 3sbp:G, 3sbp:H, 3sbq:A, 3sbq:B, 3sbr:A, 3sbr:B, 3sbr:C, 3sbr:D, 3sbr:E, 3sbr:F, 3sbr:G, 3sbr:H, 6y6y:A, 6y6y:B, 6y71:A, 6y71:B, 6y72:A, 6y72:B, 6y77:A, 6y77:B, 6y7d:A, 6y7d:B, 6y7e:A, 6y7e:B |
9 | 5na1:A | 398 | 50 | 0.1181 | 0.0377 | 0.3000 | 4.1 | 5na4:A |
10 | 8szq:A | 861 | 53 | 0.1260 | 0.0186 | 0.3019 | 6.2 | 3llm:A, 3llm:B, 8szp:A, 8szp:B, 8szr:A, 8szs:A |
11 | 4ye2:A | 142 | 66 | 0.1339 | 0.1197 | 0.2576 | 6.7 | |
12 | 1oxy:A | 573 | 46 | 0.1102 | 0.0244 | 0.3043 | 7.6 | |
13 | 1nol:A | 607 | 46 | 0.1102 | 0.0231 | 0.3043 | 8.2 | 1ll1:A, 1lla:A |
14 | 8atu:A | 2837 | 25 | 0.0866 | 0.0039 | 0.4400 | 9.3 | 8atu:B, 8atx:A, 8atx:B, 8auk:A, 8auk:B, 8auw:B |
15 | 8auw:A | 2900 | 25 | 0.0866 | 0.0038 | 0.4400 | 9.5 | |
16 | 2ong:A | 543 | 96 | 0.1811 | 0.0424 | 0.2396 | 9.6 | 2ong:B, 2onh:A, 2onh:B |