ERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEA
SLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bjv:A | 148 | 148 | 1.0000 | 1.0000 | 1.0000 | 8.01e-110 | 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B |
2 | 6d97:A | 522 | 34 | 0.0946 | 0.0268 | 0.4118 | 0.033 | 6d97:B, 6d97:C, 6d97:D |
3 | 1dux:C | 86 | 46 | 0.1216 | 0.2093 | 0.3913 | 7.6 | 1dux:F |
4 | 1uzr:B | 288 | 38 | 0.0878 | 0.0451 | 0.3421 | 8.1 | 1uzr:A, 1uzr:C |