BioLiP

>protein
EQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVDVNDIAFLDDNELTAKIEKRIS
SIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEY
FYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYKPPG

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5v7y:A	207	205	0.9849	0.9469	0.9561	7.34e-143	5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C
2	2jig:A	216	196	0.3467	0.3194	0.3520	4.20e-34	3gze:A, 3gze:C
3	2jig:B	195	181	0.3216	0.3282	0.3536	5.97e-32	3gze:B, 3gze:D
4	5c5u:B	190	170	0.2764	0.2895	0.3235	2.00e-19	5c5t:A, 5c5t:B, 5c5u:A
5	6tp5:A	370	147	0.2161	0.1162	0.2925	5.69e-11	6tp5:B
6	6tp5:A	370	53	0.0905	0.0486	0.3396	2.1	6tp5:B
7	2bb3:A	194	65	0.1256	0.1289	0.3846	0.70	2bb3:B
8	3jvt:C	156	51	0.1106	0.1410	0.4314	1.4	1b7t:Z, 1dfk:Z, 1dfl:Z, 1dfl:X, 2ec6:C, 1kk7:Z, 1kk8:C, 1kqm:C, 1kwo:C, 1l2o:C, 2os8:C, 2otg:C, 3pn7:C, 3pn7:F, 1qvi:Z, 1s5g:Z, 1scm:C, 1sr6:C, 3ts5:C, 3ts5:F, 3tuy:C, 3tuy:F, 1wdc:C
9	8k0e:A	646	73	0.1055	0.0325	0.2877	2.1	8k0f:A, 8k0m:A, 8k17:A, 8kc9:A
10	6jdb:A	290	83	0.1256	0.0862	0.3012	4.2
11	6jdc:A	269	83	0.1256	0.0929	0.3012	4.7
12	8cip:A	665	59	0.0905	0.0271	0.3051	7.2	8cip:B, 8cip:C, 8cip:D

[Back]