EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3orc:A | 65 | 65 | 1.0000 | 0.9231 | 0.9231 | 4.44e-38 | 6cro:A |
2 | 2pij:A | 59 | 58 | 0.4167 | 0.4237 | 0.4310 | 1.49e-09 | |
3 | 4zrn:A | 309 | 31 | 0.2000 | 0.0388 | 0.3871 | 0.48 | 4zrm:A, 4zrm:B, 4zrn:B |
4 | 6pcp:A | 140 | 21 | 0.1500 | 0.0643 | 0.4286 | 0.93 | 6pcp:D, 6pcp:B, 6pcp:C, 6pcp:E, 6pcp:F |
5 | 7ufr:A | 1038 | 43 | 0.2167 | 0.0125 | 0.3023 | 1.8 | 7ufr:B, 7ufr:C, 7ufr:D, 7ufu:A, 7ufu:B, 7ufu:C, 7ufu:D |
6 | 2jnx:A | 134 | 20 | 0.2000 | 0.0896 | 0.6000 | 2.6 | |
7 | 1jfk:A | 134 | 19 | 0.1667 | 0.0746 | 0.5263 | 3.6 | 3li6:A, 3li6:D, 3li6:G, 3li6:J, 2m7m:A, 2m7n:A, 2nxq:A, 2nxq:B, 3ulg:A, 3ulg:B, 5xop:A, 5xop:B, 5xop:C, 5xop:D, 5xop:E, 5xop:F |
8 | 8uhe:K | 593 | 47 | 0.2667 | 0.0270 | 0.3404 | 3.8 | |
9 | 8dq2:A | 110 | 24 | 0.1833 | 0.1000 | 0.4583 | 4.6 | 8dq2:B, 8dq2:C, 8dq2:D, 8fnr:A, 8fnr:B, 8fnr:C, 8fnr:D |
10 | 1g82:A | 157 | 25 | 0.1333 | 0.0510 | 0.3200 | 5.2 | |
11 | 8v9l:z | 375 | 62 | 0.3500 | 0.0560 | 0.3387 | 5.2 | 8v9j:z |
12 | 3f1r:A | 157 | 25 | 0.1667 | 0.0637 | 0.4000 | 9.1 | 3f1r:B |
13 | 8xku:A | 730 | 26 | 0.1833 | 0.0151 | 0.4231 | 9.3 | 8xkv:A |