EQRAVAKALFDAVNKHLSNPFIEVEMRLGQFKFTACVSTEDYERIKTYLMTEMENSSMTRSVTHDVSLGWRHTYATDENG
NPTRCVSIVRKKRLFVKNIVVPLGAYNLRFAVSTETPRLKDRLSITDGMFRYDMTQVTEKGVLMHEVEIEGVFEKQLTES
WLEELLRRAMRLATLRT
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6l7v:A | 180 | 181 | 0.9774 | 0.9611 | 0.9558 | 4.61e-122 | 6l7w:B |
2 | 6l7x:A | 203 | 201 | 0.9944 | 0.8670 | 0.8756 | 6.99e-121 | 6l7w:A, 6l7y:A |
3 | 4pn1:B | 261 | 171 | 0.1921 | 0.1303 | 0.1988 | 0.016 | 4pn1:A, 4pn1:C, 4pn1:D |
4 | 4zgs:A | 346 | 78 | 0.1130 | 0.0578 | 0.2564 | 3.7 | 4zgs:B, 4zgs:C, 4zgs:D, 4zgs:E, 4zgs:F, 4zgs:G, 4zgs:H |
5 | 7pp8:A | 402 | 46 | 0.0847 | 0.0373 | 0.3261 | 4.0 | 7pp8:B, 7pp8:C, 7pp8:D, 7pp8:E, 7pp8:F, 7pp8:G, 7pp8:H, 7pu6:A, 7pu6:B, 7pu6:C, 7pu6:D, 7pu6:E, 7pu6:F, 7pu6:G, 7pu6:H |
6 | 8con:A | 379 | 33 | 0.0565 | 0.0264 | 0.3030 | 7.2 | 4rqt:A, 4rqu:A, 4rqu:B |
7 | 5oak:A | 90 | 31 | 0.0791 | 0.1556 | 0.4516 | 7.6 | 5oak:C |
8 | 1d8h:A | 288 | 69 | 0.1073 | 0.0660 | 0.2754 | 8.1 | 1d8h:B, 1d8h:C, 1d8i:A, 1d8i:B, 1d8i:C |