EQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAHDNTTDFTFTVHRNDYLNALEILKQTAAN
IGAREAIGDTNIAKVSIVGVGMRSHAGVASRMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELD
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yei:C | 397 | 154 | 0.9872 | 0.3879 | 1.0000 | 1.29e-107 | 5yei:D, 5yei:B, 5yei:A, 5yei:F, 5yei:E, 5yei:H, 5yei:G |
2 | 2re1:A | 148 | 151 | 0.5769 | 0.6081 | 0.5960 | 1.13e-62 | |
3 | 4go7:X | 165 | 156 | 0.4679 | 0.4424 | 0.4679 | 1.26e-44 | 3s1t:A, 3s1t:B |
4 | 3ab4:A | 370 | 155 | 0.4359 | 0.1838 | 0.4387 | 5.90e-41 | 3ab4:C, 3ab4:E, 3ab4:G, 3ab4:I, 3ab4:O |
5 | 3aaw:C | 392 | 157 | 0.4359 | 0.1735 | 0.4331 | 1.26e-39 | 3aaw:A, 3aaw:B, 3aaw:D, 3ab2:A, 3ab2:B, 3ab2:C, 3ab2:D, 3ab2:E, 3ab2:F, 3ab2:G, 3ab2:H, 3ab2:I, 3ab2:J, 3ab2:K, 3ab2:L, 3ab2:M, 3ab2:N, 3ab2:O, 3ab2:P, 3ab4:B, 3ab4:D, 3ab4:F, 3ab4:H, 3ab4:J, 3ab4:K, 3ab4:L, 3ab4:M, 3ab4:N, 3ab4:P, 2dtj:A, 2dtj:B |
6 | 2dt9:A | 153 | 152 | 0.4295 | 0.4379 | 0.4408 | 5.63e-37 | 2dt9:B |
7 | 3l76:A | 585 | 158 | 0.4103 | 0.1094 | 0.4051 | 1.67e-29 | 3l76:B |
8 | 3l76:A | 585 | 157 | 0.3846 | 0.1026 | 0.3822 | 1.53e-27 | 3l76:B |
9 | 3c1m:C | 468 | 143 | 0.2885 | 0.0962 | 0.3147 | 6.85e-12 | 3c1m:A, 3c1m:B, 3c1m:D, 3c1n:A, 3c1n:B, 3c1n:C, 3c1n:D, 3c20:A, 3c20:B, 2hmf:A, 2hmf:B, 2hmf:C, 2hmf:D |
10 | 3tvi:E | 439 | 65 | 0.1859 | 0.0661 | 0.4462 | 3.84e-09 | 3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L |
11 | 2cdq:A | 470 | 63 | 0.1282 | 0.0426 | 0.3175 | 0.011 | 2cdq:B |
12 | 4bxd:A | 255 | 60 | 0.1346 | 0.0824 | 0.3500 | 3.4 | 4bxd:B, 4bxe:A, 4bxe:B |
13 | 3ihp:B | 681 | 59 | 0.1218 | 0.0279 | 0.3220 | 4.9 | 6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A |
14 | 3u48:B | 742 | 82 | 0.1218 | 0.0256 | 0.2317 | 5.5 | 3u48:A, 3u4a:B, 3u4a:A |
15 | 4fju:A | 338 | 75 | 0.1346 | 0.0621 | 0.2800 | 6.4 | 4fju:B, 4h8a:A, 4h8a:B |
16 | 8oir:Bb | 101 | 51 | 0.1090 | 0.1683 | 0.3333 | 7.6 | 6gaw:Bp, 6gb2:Bp, 7nqh:Bp, 7nql:Bp, 7nsh:Bp, 7nsi:Bp, 7nsj:Bp, 7o9m:k, 7of6:k, 8oit:Bb, 8pk0:k, 7qi5:k, 8xt0:L3, 8xt1:L3, 6ydp:Bp, 6ydw:Bp, 6zm5:k |