EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPCTNRSCPFLHEEGQR
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4lj0:A | 65 | 64 | 1.0000 | 0.9846 | 1.0000 | 3.87e-43 | 4lj0:B |
2 | 2lhn:A | 80 | 65 | 0.3438 | 0.2750 | 0.3385 | 0.001 | 5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E |
3 | 6dnh:C | 117 | 51 | 0.2656 | 0.1453 | 0.3333 | 0.50 | 8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C |
4 | 2d9n:A | 77 | 51 | 0.2656 | 0.2208 | 0.3333 | 0.50 | 2rhk:C |
5 | 5awp:A | 596 | 11 | 0.1250 | 0.0134 | 0.7273 | 0.72 | 5awq:A |
6 | 8irm:A | 540 | 37 | 0.1875 | 0.0222 | 0.3243 | 1.0 | 8irm:B, 8irn:A, 8irn:B, 8iro:B, 8iro:A, 8irp:B, 8irp:A, 8wmq:B, 8wmq:A |
7 | 8hmc:B | 1195 | 19 | 0.1094 | 0.0059 | 0.3684 | 3.0 | 8hmd:B |
8 | 8qcf:K | 915 | 31 | 0.1875 | 0.0131 | 0.3871 | 3.2 | |
9 | 5c0w:J | 970 | 31 | 0.1875 | 0.0124 | 0.3871 | 3.3 | 5k36:K, 5vzj:K |
10 | 4ifd:J | 948 | 31 | 0.1875 | 0.0127 | 0.3871 | 3.5 | 5c0x:J, 5jea:J, 2vnu:D |
11 | 3zj2:A | 71 | 18 | 0.1562 | 0.1408 | 0.5556 | 3.5 |