EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERL
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3coq:A | 89 | 57 | 1.0000 | 0.6404 | 1.0000 | 5.56e-36 | 3coq:B, 1d66:A, 1d66:B, 7uik:T, 7uik:U, 7uio:GA, 7uio:GB |
2 | 1aw6:A | 43 | 36 | 0.6316 | 0.8372 | 1.0000 | 3.91e-20 | |
3 | 1cld:A | 33 | 33 | 0.3684 | 0.6364 | 0.6364 | 3.39e-07 | |
4 | 1pyi:A | 88 | 53 | 0.3684 | 0.2386 | 0.3962 | 3.47e-04 | 1pyi:B |
5 | 2hap:C | 76 | 36 | 0.2632 | 0.1974 | 0.4167 | 0.069 | 2hap:D, 1hwt:C, 1hwt:D, 1hwt:G, 1hwt:H, 1pyc:A, 1qp9:A, 1qp9:B, 1qp9:C, 1qp9:D |
6 | 1ajy:A | 71 | 52 | 0.2807 | 0.2254 | 0.3077 | 0.083 | 1ajy:B, 1zme:C, 1zme:D |
7 | 1t8y:F | 461 | 25 | 0.2105 | 0.0260 | 0.4800 | 0.49 | 1t8s:A, 1t8s:B, 1t8s:C, 1t8s:D, 1t8s:E, 1t8s:F, 1t8y:C, 1t8y:B, 1t8y:E, 1t8y:A |
8 | 6gys:B | 579 | 52 | 0.2456 | 0.0242 | 0.2692 | 0.52 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
9 | 1adj:A | 420 | 14 | 0.1930 | 0.0262 | 0.7857 | 2.6 | 1adj:B, 1adj:C, 1adj:D, 1ady:A, 1ady:B, 1ady:C, 1ady:D, 4rdx:A |
10 | 4jwf:A | 187 | 35 | 0.2632 | 0.0802 | 0.4286 | 3.3 | 4jwf:B, 4jwh:A, 4jwh:B |
11 | 8gju:J | 689 | 29 | 0.1930 | 0.0160 | 0.3793 | 8.5 | 8gju:K, 8gju:L, 8gju:H |
12 | 2xiq:A | 714 | 29 | 0.1930 | 0.0154 | 0.3793 | 8.5 | 8dyj:B, 8dyl:B, 2xij:A, 2xiq:B |