EPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTRLTLVCSTAPG
PLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEE
APKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKEWKD
The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1doa:B | 200 | 200 | 1.0000 | 1.0000 | 1.0000 | 2.67e-150 | 4f38:B, 5fr1:B, 5fr2:B, 1hh4:D, 1hh4:E |
2 | 6vfs:A | 295 | 58 | 0.1000 | 0.0678 | 0.3448 | 2.2 | |
3 | 5iai:A | 399 | 50 | 0.0700 | 0.0351 | 0.2800 | 3.3 | |
4 | 2gej:A | 361 | 58 | 0.0900 | 0.0499 | 0.3103 | 4.2 | 2gek:A, 4n9w:A |
5 | 7ouc:AAA | 527 | 66 | 0.0900 | 0.0342 | 0.2727 | 4.2 | 7oud:AAA |
6 | 3rit:A | 354 | 25 | 0.0600 | 0.0339 | 0.4800 | 5.0 | 3rit:B, 3rit:C, 3rit:D, 3rit:E, 3ro6:B, 3ro6:A, 3ro6:C, 3ro6:D, 3ro6:E, 3ro6:F |