EPQRLFFAIDLPAEIREQIIHWRAKHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQW
LRSRVVWLGMRQPPRGLIQLANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARG
RTRYTPLKRWALTQ
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ldj:B | 175 | 174 | 1.0000 | 0.9943 | 1.0000 | 9.40e-128 | 5ldj:A, 5ldj:C, 5ldj:D, 5ldk:B, 5ldm:A, 5ldm:B, 5ldo:A, 5ldp:A, 5ldp:B, 5ldq:A, 5ldq:B, 5ldq:C, 5ldq:D, 4qak:A, 4qak:B |
2 | 5h7e:A | 182 | 156 | 0.2874 | 0.2747 | 0.3205 | 5.16e-11 | |
3 | 8s9u:E | 678 | 123 | 0.1954 | 0.0501 | 0.2764 | 0.032 | 8s9t:E, 8s9v:E, 8s9x:E |
4 | 8aq2:A | 520 | 122 | 0.1954 | 0.0654 | 0.2787 | 0.093 | |
5 | 8har:A | 357 | 118 | 0.1839 | 0.0896 | 0.2712 | 1.1 | 8har:B |
6 | 4gve:A | 197 | 60 | 0.0920 | 0.0812 | 0.2667 | 3.0 |