EPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGP
YEGRITEDEEAANNGYSWLITKGRNCYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLV
WYGDEYGQELGIKWGSKWKKELM
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ijd:A | 215 | 183 | 1.0000 | 0.8512 | 1.0000 | 5.39e-139 | 4ijd:B, 6nm4:A, 6nm4:B |
2 | 4c1q:A | 173 | 170 | 0.8361 | 0.8844 | 0.9000 | 2.06e-116 | 4c1q:B |
3 | 3ray:A | 159 | 165 | 0.3934 | 0.4528 | 0.4364 | 7.38e-47 | |
4 | 2l9z:A | 39 | 28 | 0.0546 | 0.2564 | 0.3571 | 0.066 | |
5 | 6xlp:A | 586 | 59 | 0.0984 | 0.0307 | 0.3051 | 0.56 | |
6 | 1e3e:A | 376 | 50 | 0.0874 | 0.0426 | 0.3200 | 1.8 | 1e3e:B, 1e3i:A, 1e3i:B, 1e3l:A, 1e3l:B |
7 | 6pz0:A | 185 | 63 | 0.1038 | 0.1027 | 0.3016 | 4.3 | 6pz0:B, 6q1b:A, 6q1b:B, 6q1l:A, 6q1l:B, 6tyk:A, 6tyk:B |
8 | 3lpp:B | 869 | 54 | 0.0929 | 0.0196 | 0.3148 | 5.8 | 3lpp:D |
9 | 8pjn:b | 296 | 73 | 0.1093 | 0.0676 | 0.2740 | 6.9 |