EPLAIDVHRDANCGCCKDWIKHLEANGFKVTDHVEADMSAVKSRLGVPYSMGSCHTGVIDGKFVEGHVPAADILKLRERA
DLVGAAVPGMPVGSPGMEMGDRQDAYQVVGLTRSGQASVLAEYP
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wje:A | 126 | 124 | 1.0000 | 0.9841 | 1.0000 | 5.60e-90 | 6wis:A, 6wis:B, 6wje:B, 6wje:C, 6wje:D, 6wje:E, 6wje:F |
2 | 8xme:A | 1176 | 64 | 0.1935 | 0.0204 | 0.3750 | 1.3 | 7eu0:A, 8xmb:A, 8xmc:A, 8xmd:A |
3 | 4op4:B | 265 | 62 | 0.1532 | 0.0717 | 0.3065 | 1.5 | 4op4:A |
4 | 5frt:E | 105 | 52 | 0.1290 | 0.1524 | 0.3077 | 1.7 | 5ffi:E |
5 | 7eu1:A | 1065 | 35 | 0.1290 | 0.0150 | 0.4571 | 2.8 | |
6 | 8kcc:K | 508 | 42 | 0.1048 | 0.0256 | 0.3095 | 4.0 | 8j90:K, 8kcb:K, 8wh5:K, 8wh8:K, 8wh9:K, 8wha:K, 8wha:L |
7 | 1ayo:B | 130 | 46 | 0.0968 | 0.0923 | 0.2609 | 6.2 | |
8 | 5zdm:A | 198 | 36 | 0.0968 | 0.0606 | 0.3333 | 7.1 | 5zdn:A |
9 | 5csr:C | 220 | 38 | 0.0968 | 0.0545 | 0.3158 | 9.7 | 5csr:A, 5csr:B, 5csr:D, 5css:A, 5css:B, 5css:C, 5css:D |