EPETALLVAFVAYYTALIALIFAILATRRLM
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6wa0:B | 31 | 31 | 1.0000 | 1.0000 | 1.0000 | 1.52e-14 | 6wa0:C, 6wa0:E, 6wa0:H, 6wa0:I |
| 2 | 7zk3:A | 721 | 25 | 0.3226 | 0.0139 | 0.4000 | 6.5 | 7b5c:A, 7b5c:B, 7b5e:A, 7b5e:B, 5oyb:A, 5oyb:B, 7zk3:B |
| 3 | 7amv:W | 637 | 28 | 0.3226 | 0.0157 | 0.3571 | 8.4 |
umich.edu