BioLiP

>protein
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNV
RTRLEILEKGLAT

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4u7i:A	93	93	1.0000	1.0000	1.0000	1.21e-64
2	7s7j:A	84	85	0.3441	0.3810	0.3765	5.99e-09
3	5tzy:A	418	49	0.1935	0.0431	0.3673	0.048
4	5w93:A	133	75	0.2043	0.1429	0.2533	0.51	5w93:B, 5w93:C
5	6zfz:A	446	57	0.2043	0.0426	0.3333	0.97	5cxv:A, 6wjc:A, 6zg4:A, 6zg9:A
6	4v5o:AE	230	45	0.1075	0.0435	0.2222	1.7	4bts:AE, 4bts:BE, 4bts:CE, 4bts:DE, 4v5o:BE
7	5ee7:A	416	43	0.1828	0.0409	0.3953	1.9
8	4xes:A	471	62	0.2043	0.0403	0.3065	2.1	4buo:B, 8fmz:A, 8fn0:A, 8fn1:A, 7l0p:C, 7l0q:C, 7l0r:C, 7l0s:C, 4xee:A
9	8d97:A	1600	53	0.2151	0.0125	0.3774	2.3
10	7y82:A	1341	53	0.2151	0.0149	0.3774	2.4
11	8gna:A	1188	53	0.2151	0.0168	0.3774	2.4
12	8d8n:B	1256	53	0.2151	0.0159	0.3774	2.5	8d9e:B, 8d9i:B, 7y81:A
13	7y84:A	1242	52	0.2151	0.0161	0.3846	2.6	7x7a:A, 7x7r:A, 7xc7:A, 7y83:A, 7y85:A
14	7y80:A	1218	52	0.2151	0.0164	0.3846	2.7	8gu6:A
15	7xss:B	1282	52	0.2151	0.0156	0.3846	2.7	8d9f:B, 8d9h:B, 7x8a:A, 7xso:A, 7xsp:B, 7xt4:B
16	7y8t:A	1298	53	0.2151	0.0154	0.3774	2.8	8d9g:B, 7xsq:A, 7xsr:B, 7y8y:A
17	8jwz:A	450	56	0.1935	0.0400	0.3214	3.0	3eml:A, 8jwy:A, 3qak:A, 5wf5:A, 5wf6:A
18	8w1v:A	441	53	0.1828	0.0385	0.3208	3.1	8w1v:B
19	8gji:A	167	32	0.1398	0.0778	0.4062	6.1
20	8bvf:B	403	30	0.1183	0.0273	0.3667	6.6	8bvf:A
21	6ol9:A	416	46	0.1613	0.0361	0.3261	8.1
22	4ayg:A	1028	48	0.1398	0.0126	0.2708	8.9	4ayg:B, 3hz3:A, 3klk:A, 3kll:A

[Back]