ENTSENRAQVAARQHNRKIVEQYMHTRGEARLKRHLLFTEDGVGGLWTTDSGQPIAIRGREKLGEHAVWSLQCFPDWVWT
DIQIFETQDPNWFWVECRGEGAIVFPGYPRGQYRNHFLHSFRFENGLIKEQREFMNPCEQFRSLGIEVPEVRRDGL
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3b4p:B | 158 | 156 | 1.0000 | 0.9873 | 1.0000 | 1.62e-116 | 3b4p:A, 3cnm:A, 3cnm:B, 3dzl:A, 3dzl:B, 3jum:A, 3jum:B, 3jun:A, 3jun:B, 3juo:A, 3juo:B, 3jup:A, 3jup:B, 3juq:A, 3juq:B |
2 | 5bvb:A | 130 | 112 | 0.2051 | 0.2462 | 0.2857 | 6.49e-06 | 5bvb:B, 5bvb:C, 5bvb:D |
3 | 4j8t:A | 128 | 111 | 0.1987 | 0.2422 | 0.2793 | 3.13e-05 | 4j8t:B, 4j8t:C, 4j8t:D, 4j9a:A, 4j9a:B, 4j9a:C, 4j9a:D, 4j9a:E, 4j9a:F, 4j9a:H |
4 | 4j9a:I | 111 | 105 | 0.1795 | 0.2523 | 0.2667 | 0.098 | 4j9a:G |
5 | 5lsm:A | 339 | 27 | 0.0769 | 0.0354 | 0.4444 | 0.84 | 5lsm:B, 5lsm:C, 5lsm:D, 5lsm:E, 5lsm:F, 5lsm:G, 5lsm:H |