ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA
The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gxq:B | 54 | 54 | 1.0000 | 1.0000 | 1.0000 | 8.17e-34 | 3gxq:A |
2 | 2qgs:A | 209 | 59 | 0.2963 | 0.0766 | 0.2712 | 2.3 | 2qgs:B |
3 | 7xnz:B | 458 | 26 | 0.1852 | 0.0218 | 0.3846 | 3.2 | 7xnz:A, 7xnz:C, 7xnz:D, 7xoh:B, 7xoh:A, 7xoh:C, 7xoh:D, 7xoy:B, 7xoy:A, 7xoy:C, 7xoy:D |
4 | 3egw:B | 509 | 23 | 0.1667 | 0.0177 | 0.3913 | 4.4 | 3ir5:B, 3ir6:B, 3ir7:B, 1q16:B, 1r27:B, 1r27:D, 1siw:B, 1y4z:B, 1y5i:B, 1y5l:B, 1y5n:B |
5 | 8bwy:C | 4264 | 32 | 0.2407 | 0.0030 | 0.4062 | 4.8 | |
6 | 7moq:C | 4159 | 32 | 0.2407 | 0.0031 | 0.4062 | 5.1 | 6zyy:C |
7 | 8bx8:A | 4453 | 32 | 0.2407 | 0.0029 | 0.4062 | 5.1 | 7k58:A, 7k5b:A, 7kek:A |
8 | 6zyw:C | 4433 | 32 | 0.2407 | 0.0029 | 0.4062 | 5.3 | |
9 | 3od2:A | 132 | 25 | 0.1852 | 0.0758 | 0.4000 | 7.3 | 3bkt:A, 3bkt:B, 3bkt:C, 3bkt:D, 2hza:A, 2hza:B, 2hzv:A, 2hzv:B, 2hzv:C, 2hzv:D, 2hzv:E, 2hzv:F, 2hzv:G, 2hzv:H, 3od2:B, 1q5y:A, 1q5y:C, 1q5y:B, 1q5y:D |