ENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYI
YEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLC
KSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYV
SPNQMYVLDYLIYHLRPYGIINTPDALPNKLAVGELMPE
The query sequence (length=279) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7q4i:B | 281 | 279 | 1.0000 | 0.9929 | 1.0000 | 0.0 | 7q4i:A |
2 | 2j0b:A | 243 | 135 | 0.1075 | 0.1235 | 0.2222 | 0.12 | |
3 | 6kfa:A | 162 | 30 | 0.0502 | 0.0864 | 0.4667 | 4.9 | 6kfb:A, 6kfd:A |
4 | 2iqx:C | 186 | 85 | 0.0789 | 0.1183 | 0.2588 | 6.2 | 2iqx:A, 2iqx:B |
5 | 2hnk:B | 232 | 34 | 0.0394 | 0.0474 | 0.3235 | 8.2 | 2hnk:A, 2hnk:C |
6 | 6nkf:A | 301 | 60 | 0.0573 | 0.0532 | 0.2667 | 8.9 | 6nkf:D |
7 | 1b12:C | 226 | 28 | 0.0394 | 0.0487 | 0.3929 | 9.3 | 1b12:B, 3iiq:A, 3iiq:B, 3s04:B, 3s04:A, 1t7d:A, 1t7d:B |