Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF

The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4o62:B 57 57 1.0000 1.0000 1.0000 9.82e-38 4o62:A, 4o62:C, 4z0o:A, 4z0r:B, 4z0r:A, 4z0r:C
2 2e61:A 69 50 0.4211 0.3478 0.4800 1.14e-07 2rr4:A
3 6qxz:A 79 52 0.2982 0.2152 0.3269 3.68e-07
4 2l7p:A 100 48 0.2982 0.1700 0.3542 1.78e-06 5yvx:A
5 6o5w:A 57 50 0.3509 0.3509 0.4000 9.17e-06
6 5ix1:A 414 51 0.3684 0.0507 0.4118 4.04e-05
7 6o1e:A 431 51 0.3684 0.0487 0.4118 8.47e-05 5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A
8 7xe1:A 751 49 0.2982 0.0226 0.3469 0.008 4fwe:A, 4fwf:A, 4fwj:A, 4fwj:B, 4gu0:A, 4gu0:C, 4gu0:B, 4gu0:D, 4gu1:A, 4gu1:B, 4gur:A, 4gus:A, 4gut:A, 4guu:A, 4hsu:A, 6r1u:K, 6r25:K, 7xe1:B, 7xe2:A, 7xe2:B, 7xe3:A, 7xe3:B
9 5ofb:B 541 46 0.2807 0.0296 0.3478 0.015 5of9:A, 5of9:B, 5ofa:B, 5ofa:A, 5ofb:A
10 8t3p:A 477 23 0.1579 0.0189 0.3913 3.2 8t3p:B
11 8pvs:A 731 48 0.2105 0.0164 0.2500 8.4 8pvs:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218