ENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRK
QREVAQQFTHARNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFA
NRRKEEA
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pi9:B | 177 | 171 | 1.0000 | 0.9435 | 0.9766 | 6.01e-122 | 1ic8:A, 1ic8:B, 8pi7:A, 8pi7:B, 8pi8:A, 8pi8:B, 8pi9:A, 8pia:A, 8pia:B |
2 | 2h8r:A | 176 | 168 | 0.8323 | 0.7898 | 0.8274 | 6.93e-104 | 2h8r:B |
3 | 4j19:A | 77 | 73 | 0.1497 | 0.3247 | 0.3425 | 1.34e-04 | 4j19:B |
4 | 8x7u:D | 654 | 59 | 0.1078 | 0.0275 | 0.3051 | 2.5 | 8x7u:E, 8x7u:C, 8x7u:B, 8x7u:F, 8x7u:A |
5 | 4omy:A | 97 | 62 | 0.1198 | 0.2062 | 0.3226 | 9.2 | 4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D |