BioLiP

>protein
ENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKR
VFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIM

The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6gym:3	138	138	1.0000	1.0000	1.0000	1.45e-98	8cen:3, 8ceo:3, 7ml0:3, 7ml1:3, 7ml2:3, 7ml3:3, 7o4i:3, 7o4j:3, 7o4k:3, 7o4l:3, 7o72:3, 7o73:3, 7o75:3, 5oqj:3, 5oqm:3, 7zs9:3, 7zsa:3, 7zsb:3
2	7nvr:3	214	132	0.4348	0.2804	0.4545	7.28e-34
3	7egb:0	236	132	0.4348	0.2542	0.4545	1.31e-33	7egc:0
4	7lbm:d	275	132	0.4348	0.2182	0.4545	2.03e-33	8byq:7
5	7enc:0	306	132	0.4348	0.1961	0.4545	3.62e-33	1g25:A, 8gxq:HD, 8gxs:HD, 6nmi:H, 7nvw:3, 7nvx:3, 7nvy:3, 7nvz:3, 8wak:0, 8wal:0, 8wan:0, 8wao:0, 8wap:0, 8waq:0, 8war:0, 8was:0
6	2ct2:A	88	74	0.1884	0.2955	0.3514	0.002	5fey:A, 5fey:B
7	7bbd:B	160	43	0.1087	0.0938	0.3488	0.043	8a58:C, 8a58:D, 8c07:I, 8f1f:C, 8f1f:c, 6fga:A, 6fga:B, 6fga:C, 6fga:D, 6fga:E, 6fga:F, 6fga:G, 6fga:H, 5m93:B, 5m93:C, 7nbb:C, 5o44:E, 6s53:B, 6s53:A, 6s53:H, 6s53:G, 3zlz:B
8	5olm:B	132	75	0.1522	0.1591	0.2800	0.12	5jpx:A, 5olm:A
9	5tte:B	442	75	0.1667	0.0520	0.3067	1.0	7b5m:H, 2m9y:A, 1wd2:A
10	7b5l:H	423	71	0.1522	0.0496	0.2958	1.2	7b5n:H, 4kc9:A, 5udh:A
11	1z6u:A	115	59	0.1304	0.1565	0.3051	1.2	1z6u:B
12	2eci:A	86	75	0.1522	0.2442	0.2800	1.4
13	6wi7:A	206	44	0.1087	0.0728	0.3409	1.4	2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B
14	4kbl:A	395	71	0.1522	0.0532	0.2958	1.7	4kbl:B, 5udh:B
15	4r8p:L	254	44	0.1087	0.0591	0.3409	1.9	2ckl:B, 8grm:N, 2h0d:B, 7nd1:A, 8pp7:L, 8pp7:N, 4r8p:N, 3rpg:C, 4s3o:B, 4s3o:E
16	2ecy:A	66	29	0.0870	0.1818	0.4138	1.9
17	1cl1:B	392	26	0.0870	0.0306	0.4615	2.3	1cl1:A, 1cl2:A, 1cl2:B, 2fq6:A, 2fq6:B, 2gqn:A, 2gqn:B, 4itx:A, 4itx:B
18	3i4l:A	524	44	0.0870	0.0229	0.2727	2.6	3i73:A
19	6nyt:A	135	54	0.1159	0.1185	0.2963	2.9
20	3knv:A	123	22	0.0725	0.0813	0.4545	3.7
21	6ox1:B	484	63	0.1304	0.0372	0.2857	7.1	6ict:A, 6ict:B, 6ict:C, 6ict:D, 6icv:A, 6icv:B, 6jat:A, 6jat:C, 7lms:A, 6mbj:A, 6mbj:B, 6mbk:A, 6mbk:B, 6mbl:A, 6ox0:A, 6ox0:B, 6ox1:A, 6ox2:A, 6ox2:B, 6ox3:A, 6ox3:B, 6ox4:A, 6ox4:B, 6ox5:A, 3smt:A, 6v62:A, 6v63:A, 6v63:B, 7w28:A, 7w29:A, 6wk1:A, 6wk1:B, 6wk2:A, 6wk2:D, 8x77:B
22	6vu9:A	631	86	0.1594	0.0349	0.2558	7.3
23	3hcs:A	157	75	0.1522	0.1338	0.2800	8.7	3hcs:B, 3hct:A, 3hcu:A, 3hcu:C, 8hz2:A, 8hz2:B, 2jmd:A, 7l3l:B, 7l3l:D
24	5vo0:D	159	75	0.1449	0.1258	0.2667	8.9	5vnz:A, 5vnz:D, 5vo0:A
25	7v1l:B	221	60	0.1014	0.0633	0.2333	9.6	7v6p:A

[Back]