BioLiP

>protein
EMSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVD
IAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPK
QASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYG
DFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVV
KVTIDYTEISFMLWCKDGHVETFYPKL

The query sequence (length=347) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7n7r:B	348	346	0.9971	0.9943	1.0000	0.0	7k0r:A, 7k0r:B, 7k0r:C, 7k0r:D, 7k0r:E, 7k0r:F, 7k1l:A, 7k1l:B, 7k1o:A, 7k1o:B, 7k1o:C, 7n06:A, 7n06:B, 7n06:C, 7n06:D, 7n06:E, 7n06:F, 7n33:A, 7n33:B, 7n33:C, 7n33:D, 7n33:E, 7n33:F, 7n7u:A, 7n7u:B, 7n7w:B, 7n7y:A, 7n7y:B, 7n83:A, 7n83:B, 5s6x:A, 5s6x:B, 5s6y:A, 5s6y:B, 5s6z:A, 5s6z:B, 5s71:B, 5s72:A, 5sa4:B, 5sa5:B, 5sa6:A, 5sa6:B, 5sa7:A, 5sa8:A, 5sa8:B, 5sa9:B, 5saa:A, 5saa:B, 5sab:B, 5sac:B, 5sad:B, 5sae:A, 5sae:B, 5saf:A, 5saf:B, 5sag:B, 5sah:A, 5sah:B, 5sai:B, 7tj2:A, 7tj2:E, 7tqv:A, 7tqv:C, 7tqv:E, 8ud3:B, 8ud3:A, 8ud4:B, 8ud4:A, 8ud5:D, 8ud5:B, 8ud5:A, 6vww:A, 6wlc:A, 6wlc:B, 6wxc:A, 6wxc:B, 6x1b:A, 6x1b:B, 6x4i:A, 6x4i:B
2	8x1a:B	319	83	0.0720	0.0784	0.3012	3.0
3	4std:A	164	35	0.0346	0.0732	0.3429	3.1	1std:A, 2std:A, 3std:A, 3std:B, 3std:C, 4std:B, 4std:C, 5std:A, 5std:B, 5std:C, 6std:A, 6std:B, 6std:C, 7std:A, 7std:B, 7std:C
4	4jap:C	353	83	0.0720	0.0708	0.3012	6.0	4jao:C, 4jao:B, 4jap:B, 4jap:A, 4jaq:D, 4jaq:A, 4jaq:C, 4jaq:B, 4jd3:C, 4jd3:B
5	2e7w:A	150	83	0.0663	0.1533	0.2771	8.3	2e7x:A, 2efp:A, 2efq:A, 2pmh:A, 2pn6:A, 2yx4:A, 2yx7:A

[Back]