BioLiP

>protein
EMGAWKPLGISARRRAMLRKEVLTNGEDWPYDPERKAMRTKRKGHKCDRISAEKRENTAKLMLKMPQMLLDYKKRRWEKK
MKEEEKA

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6xyw:AK	87	87	1.0000	1.0000	1.0000	1.20e-58
2	3uji:L	208	44	0.1724	0.0721	0.3409	0.28
3	8a22:AJ	122	68	0.2299	0.1639	0.2941	1.1	8apn:AJ, 8apo:AJ
4	7l08:q	168	37	0.1379	0.0714	0.3243	1.4	7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q
5	1bbo:A	57	37	0.1379	0.2105	0.3243	1.7	3znf:A, 4znf:A
6	6ywe:b	161	42	0.1954	0.1056	0.4048	1.8	6yws:b, 6ywv:b, 6ywx:b, 6ywy:b
7	6y41:F	220	33	0.1379	0.0545	0.3636	5.2	6y41:A, 6y41:B, 6y41:C, 6y41:D, 6y41:E, 6y41:G, 6y41:H, 6y41:I, 6y41:J, 6y41:K, 6y41:L, 6y41:M, 6y41:N, 6y41:O, 6y41:P
8	7mop:A	2445	31	0.1034	0.0037	0.2903	9.2	6fyh:A, 6pfl:A, 6pfl:B, 8r7o:A, 8r7o:C, 8rd0:C, 8rd0:D, 8rd1:A, 8rd1:C, 8rd1:D, 8rd7:D, 6xz1:A
9	7pkt:J	114	78	0.2299	0.1754	0.2564	9.4

[Back]