ELRLLSKTLQGQSYRDQLELNPDVSKAINNNIMAVHIPNNLRRVATNYYKEIQEPNSLHRPCRTKMEVDAHIASIFLQNY
GSIFQSLKELQKRVGPDNFKPQRILDVGYGPATGIVALNDILGPNYRPDLKDAVILGNAEMQERAKIILSRQLIMTNLRS
SIPASKEYDLIILTHQLLHDGNQFPIQVDENIEHYLNILAPGGHIVIIERGNPMGFEIIARARQITLRPENFPDEFGKIP
RPWNYFLKVIAPCPHQRKCPLQVGNPNFYTHKEGKDLKFCNFQKSIKRPKFSIELKKGKLLATSWDNGRDYEILNYSYLI
FERSHKDENTLKEIKKLRNENVNGKYDIGSLGDDTQNSWPRIINDPVKRKGHVMMDLCAPSGELEKWTVSRSFSKQIYHD
ARKSKKGDLWASAAKTQIKGLGDLNVKKFQLKKEERQKARKAMESYN
The query sequence (length=447) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8d8j:0 | 493 | 456 | 1.0000 | 0.9067 | 0.9803 | 0.0 | 8d8k:0, 8d8l:0, 8om2:c |
2 | 8csu:7 | 414 | 348 | 0.1790 | 0.1932 | 0.2299 | 1.68e-10 | 8csp:7, 8csq:7, 8csr:7, 8css:7, 8cst:7 |
3 | 6sgb:F1 | 889 | 174 | 0.0872 | 0.0439 | 0.2241 | 0.004 | 6sg9:F1, 6sga:F1 |
4 | 3e8s:A | 220 | 155 | 0.0917 | 0.1864 | 0.2645 | 0.006 | |
5 | 2zwv:A | 373 | 134 | 0.0738 | 0.0885 | 0.2463 | 4.0 | 3dmf:A, 3dmg:A, 3dmh:A, 2zul:A |
6 | 3ofk:A | 204 | 42 | 0.0336 | 0.0735 | 0.3571 | 6.9 | 3ofk:B, 3ofk:C, 3ofk:D |