ELNPSLVISLSTGVSLFLGRFVFFNFQRENVGKQVPSQNGISHFEAGDERAKEYVSLLKSNDPVGFNIVDVLAWGSIGHI
VAYYILATSSNGYDPNFF
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wgh:G | 98 | 98 | 1.0000 | 1.0000 | 1.0000 | 3.93e-68 | |
2 | 5zji:G | 97 | 97 | 0.8571 | 0.8660 | 0.8660 | 3.35e-60 | |
3 | 3lw5:G | 95 | 94 | 0.8571 | 0.8842 | 0.8936 | 5.95e-60 | 6igz:G, 2o01:G, 2wsc:G, 2wse:G, 2wsf:G, 4xk8:G, 4xk8:g |
4 | 7wg5:AG | 99 | 98 | 0.8776 | 0.8687 | 0.8776 | 2.11e-59 | 7dkz:G, 8j6z:G, 8j7a:G, 8j7b:G, 5l8r:G, 7wfd:AG, 7wfe:BG, 7wg5:BG, 6yac:G, 6yez:G, 6zoo:G, 6zxs:G |
5 | 8bcv:G | 94 | 94 | 0.8061 | 0.8404 | 0.8404 | 9.76e-56 | |
6 | 4y28:G | 91 | 95 | 0.7551 | 0.8132 | 0.7789 | 1.33e-47 | |
7 | 6l35:G | 98 | 98 | 0.6327 | 0.6327 | 0.6327 | 4.93e-43 | 8htu:G, 7ksq:G, 7kux:G, 7xqp:G |
8 | 4rku:G | 84 | 88 | 0.6939 | 0.8095 | 0.7727 | 1.10e-41 | |
9 | 7a4p:G | 99 | 94 | 0.5204 | 0.5152 | 0.5426 | 5.71e-32 | 6zzx:G, 6zzy:G |
10 | 7yca:G | 95 | 86 | 0.4490 | 0.4632 | 0.5116 | 2.32e-27 | |
11 | 7zq9:G | 95 | 92 | 0.3776 | 0.3895 | 0.4022 | 3.84e-17 | 7d0j:G, 7dz7:G, 7dz8:G, 8h2u:G, 7zqd:G, 7zqd:G2 |
12 | 7zqc:G | 80 | 89 | 0.3673 | 0.4500 | 0.4045 | 2.29e-16 | 7bgi:G, 7blx:G, 6jo5:G, 6jo6:G |
13 | 8cmo:G | 93 | 93 | 0.3061 | 0.3226 | 0.3226 | 1.80e-14 | |
14 | 6ijo:G | 70 | 89 | 0.3265 | 0.4571 | 0.3596 | 5.32e-14 | 7r3k:G |
15 | 6sl5:G | 101 | 98 | 0.3469 | 0.3366 | 0.3469 | 4.95e-08 | |
16 | 7a4p:K | 86 | 80 | 0.3061 | 0.3488 | 0.3750 | 4.62e-07 | 6zzx:K, 6zzy:K |
17 | 6igz:K | 80 | 84 | 0.2857 | 0.3500 | 0.3333 | 2.53e-06 | |
18 | 8j6z:K | 84 | 81 | 0.2755 | 0.3214 | 0.3333 | 8.53e-06 | 7dkz:K, 8j7b:K, 5l8r:K, 4rku:K, 6yac:K, 6yez:K, 6zoo:K, 6zxs:K |
19 | 8bcv:K | 88 | 82 | 0.2959 | 0.3295 | 0.3537 | 1.71e-05 | 7ew6:K, 7ewk:K, 7f9o:K, 7f9o:n, 2wse:K, 5zji:K |
20 | 8htu:K | 81 | 81 | 0.2449 | 0.2963 | 0.2963 | 1.63e-04 | 7ksq:K, 7kux:K, 6l35:K, 7xqp:K |
21 | 8cmo:K | 89 | 29 | 0.1633 | 0.1798 | 0.5517 | 2.19e-04 | |
22 | 7wfd:AK | 65 | 29 | 0.1224 | 0.1846 | 0.4138 | 3.11e-04 | 7wfe:BK, 7wg5:AK, 7wg5:BK |
23 | 8wgh:K | 83 | 82 | 0.2551 | 0.3012 | 0.3049 | 3.34e-04 | |
24 | 7dz7:K | 86 | 20 | 0.1531 | 0.1744 | 0.7500 | 3.96e-04 | 7bgi:K, 7blx:K, 7d0j:K, 7dz8:K, 6ijj:K, 6ijo:K, 7r3k:K, 7zq9:K, 7zqc:K, 7zqd:K, 7zqd:K2 |
25 | 8j7a:K | 56 | 26 | 0.1122 | 0.1964 | 0.4231 | 0.005 | |
26 | 5uty:H | 232 | 97 | 0.3061 | 0.1293 | 0.3093 | 0.009 | 9ber:H, 5d9q:H, 5d9q:F, 5d9q:N, 5fyl:H, 7lx2:H, 7lx2:N, 7lx2:P, 7lx3:H, 7lx3:N, 7lx3:P, 7lxm:H, 7lxm:N, 7lxm:P, 7lxn:H, 7lxn:I, 7lxn:J, 6ot1:m, 6ot1:F, 6ot1:Q, 4tvp:H, 6vlr:C |
27 | 7yca:K | 87 | 50 | 0.2347 | 0.2644 | 0.4600 | 0.013 | |
28 | 6sl5:K | 84 | 72 | 0.2245 | 0.2619 | 0.3056 | 1.5 | |
29 | 8wm6:K | 69 | 31 | 0.1429 | 0.2029 | 0.4516 | 2.0 | 8wmj:K, 8wmv:K, 8wmw:K |
30 | 4xk8:k | 46 | 17 | 0.0918 | 0.1957 | 0.5294 | 2.3 | 4xk8:K |
31 | 6kik:A | 275 | 55 | 0.1735 | 0.0618 | 0.3091 | 3.2 | 5dan:A, 6kiy:A, 6ky6:A, 6ky6:B |
32 | 3tox:A | 254 | 42 | 0.1531 | 0.0591 | 0.3571 | 3.8 | 3tox:B, 3tox:C, 3tox:D, 3tox:E, 3tox:F, 3tox:G, 3tox:I |
33 | 8b4l:C | 311 | 18 | 0.0918 | 0.0289 | 0.5000 | 4.1 | 8b4l:E, 8b4l:A, 8b4l:B, 8b4l:D, 8b4l:F, 8b4m:B, 8b4m:D, 8b4m:E, 8b4m:F |
34 | 5odn:D | 106 | 28 | 0.1020 | 0.0943 | 0.3571 | 6.5 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
35 | 4a42:A | 127 | 14 | 0.1020 | 0.0787 | 0.7143 | 7.0 | 4a42:B |
36 | 7mqa:SI | 803 | 49 | 0.1327 | 0.0162 | 0.2653 | 7.2 | |
37 | 7mq8:SI | 844 | 49 | 0.1327 | 0.0154 | 0.2653 | 7.2 | 7mq9:SI |
38 | 3ib9:A | 521 | 28 | 0.1429 | 0.0269 | 0.5000 | 7.3 | 3ib9:B, 1xny:A, 1xny:B |