BioLiP

>protein
ELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTP
LKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHR
ERKQDFSAFKQTDSEMKVKISPQLLLAMHRFLATEVEAFSPSQMSEKILLRLLKHPNVIQELKYDEKNKKAPEYYLYQRN
KPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALTASPVLLQVYIPDYSVRALSDLQFVKISRQQYQNALMLEHH

The query sequence (length=319) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6n7e:D	319	319	1.0000	1.0000	1.0000	0.0	4iy0:A, 5lxq:A, 5lxq:H, 6n7e:A, 4p1g:A, 4p1o:A, 4p1o:B
2	6n7e:C	302	327	0.9154	0.9669	0.8930	0.0	6n7e:B
3	5k25:C	150	147	0.3323	0.7067	0.7211	1.42e-74
4	7cfk:B	166	139	0.1442	0.2771	0.3309	1.55e-13	7cfi:A, 7cfk:A
5	3jtf:B	125	126	0.1191	0.3040	0.3016	1.57e-12	3jtf:A
6	7m1t:A	321	132	0.1348	0.1340	0.3258	4.46e-10	7m1t:B, 7msu:A
7	4hg0:A	232	137	0.1223	0.1681	0.2847	1.58e-09	3nqr:A, 3nqr:B, 3nqr:C, 3nqr:D, 5yz2:A, 5yz2:B
8	3lfr:B	128	125	0.1097	0.2734	0.2800	1.60e-07	3lfr:A
9	3oi8:A	156	96	0.0940	0.1923	0.3125	3.16e-06	3oi8:B
10	3hf7:A	127	127	0.0972	0.2441	0.2441	0.010
11	3lhh:A	125	124	0.0940	0.2400	0.2419	0.23
12	4xbo:A	228	46	0.0470	0.0658	0.3261	0.25	4cne:A, 4cne:B, 4xbo:B
13	2uvh:A	404	137	0.1160	0.0916	0.2701	0.38	2uvi:A, 2uvj:A
14	8h1c:B	983	66	0.0690	0.0224	0.3333	0.84	8h1c:A, 7xjz:A, 7xk0:A, 7xk1:A, 7xk1:C
15	7pzb:A	227	55	0.0439	0.0617	0.2545	6.5	7pza:A, 7pza:B, 7pzb:B
16	7nnl:B	682	41	0.0408	0.0191	0.3171	7.4	2a00:A, 2a29:A, 7bgy:B, 7bh1:B, 7bh2:B, 6hra:B, 6hrb:B, 7lc3:B, 7lc6:B, 5mrw:B, 5mrw:F, 5mrw:J, 7nnp:B, 7zrd:B, 7zre:B, 7zrg:B, 7zrh:B, 7zri:B, 7zrj:B, 7zrk:B, 7zrl:B, 7zrm:B

[Back]