BioLiP

>protein
ELIVYFSTQSNNTHRFVQKLDAESIRIPIDEEERIKVDEDYVLIVPTYSGGKVTQVDAHGAVPKQVIHFLNDPDNRKHCL
GVISSGNTNFGDSFAIAGPVISYKLKVPLLYQFELIGTKEDVEEVNRIISETFN

The query sequence (length=134) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mmp:E	139	137	1.0000	0.9640	0.9781	6.34e-95	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
2	7mmq:G	124	134	0.9179	0.9919	0.9179	1.21e-84
3	3n3a:C	131	131	0.5075	0.5191	0.5191	1.97e-46	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	4bmo:B	118	122	0.3358	0.3814	0.3689	5.34e-19	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
5	1rlj:A	135	134	0.3507	0.3481	0.3507	4.04e-15
6	4n82:B	153	148	0.3358	0.2941	0.3041	3.94e-11	4n82:A
7	8g64:A	169	80	0.1791	0.1420	0.3000	0.061
8	1itw:A	740	38	0.1194	0.0216	0.4211	0.65	1itw:B, 1itw:C, 1itw:D, 1j1w:A, 1j1w:B, 1j1w:C, 1j1w:D
9	8xus:B	1063	55	0.1418	0.0179	0.3455	1.5	8if2:B
10	8bon:B	1070	55	0.1418	0.0178	0.3455	1.6	8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A
11	8h3m:C	930	55	0.1418	0.0204	0.3455	1.7
12	7y1u:A	723	38	0.0970	0.0180	0.3421	3.2
13	1tqy:A	421	58	0.1343	0.0428	0.3103	8.5	1tqy:C, 1tqy:E, 1tqy:G
14	4fbg:A	399	27	0.0746	0.0251	0.3704	8.7	4fbg:E, 4fbg:G, 4fbg:H, 4fbg:I, 4fbg:K, 4fbg:M, 4fbg:P
15	8jaf:A	320	30	0.0896	0.0375	0.4000	9.5	8j97:A, 8ja3:B, 8ja3:A

[Back]