BioLiP

>protein
ELIVYFSTQSNNTHRFVQKLDAESIRIPIDEEERIKVDEDYVLIVPTYSGGKVTDAGQVDAHGAVPKQVIHFLNDPDNRK
HCLGVISSGNTNFGDSFAIAGPVISYKLKVPLLYQFELIGTKEDVEEVNRIISETFN

The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mmp:E	139	137	1.0000	0.9856	1.0000	2.15e-99	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
2	7mmq:G	124	137	0.8978	0.9919	0.8978	3.85e-84
3	3n3a:C	131	134	0.4964	0.5191	0.5075	8.05e-46	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	4bmo:B	118	125	0.3285	0.3814	0.3600	1.73e-18	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
5	1rlj:A	135	136	0.3358	0.3407	0.3382	4.10e-15
6	4n82:B	153	150	0.3431	0.3072	0.3133	6.80e-13	4n82:A
7	8g64:A	169	115	0.2190	0.1775	0.2609	0.085
8	8xus:B	1063	55	0.1387	0.0179	0.3455	1.8	8if2:B
9	8bon:B	1070	55	0.1387	0.0178	0.3455	1.8	8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A
10	8h3m:C	930	55	0.1387	0.0204	0.3455	2.0
11	2c80:A	208	54	0.1460	0.0962	0.3704	3.2	2c80:B, 2ca8:A, 2caq:A, 2f8f:A, 2f8f:B, 1oe7:A, 1oe7:B, 1oe8:A, 1oe8:B
12	1u3i:A	208	50	0.1387	0.0913	0.3800	3.6
13	4gx2:B	548	54	0.1387	0.0347	0.3519	4.5	4gvl:A, 4gvl:B, 4gvl:D, 4gvl:C, 4gx0:B, 4gx0:C, 4gx1:B, 4gx1:C, 4gx2:C, 4gx5:B, 4gx5:C
14	4gx0:D	376	48	0.1314	0.0479	0.3750	5.8	4gx0:A, 4gx1:A, 4gx1:D, 4gx2:A, 4gx2:D, 4gx5:A, 4gx5:D
15	7t7u:D	168	76	0.1752	0.1429	0.3158	6.1	4lms:B, 4lms:D, 7t7u:B
16	4fbg:A	399	27	0.0730	0.0251	0.3704	8.9	4fbg:E, 4fbg:G, 4fbg:H, 4fbg:I, 4fbg:K, 4fbg:M, 4fbg:P
17	8jaf:A	320	30	0.0876	0.0375	0.4000	9.2	8j97:A, 8ja3:B, 8ja3:A

[Back]