BioLiP

>protein
ELIVYFSTQSNNTHRFVQKLDAESIRIPIDEEERIKVDEDYVLIVPTYSGGGAVPKQVIHFLNDPDNRKHCLGVISSGNT
NFGDSFAIAGPVISYKLKVPLLYQFELIGTKEDVEEVNRIISETFNA

The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mmp:E	139	138	1.0000	0.9137	0.9203	3.83e-88	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
2	7mmq:G	124	126	0.9685	0.9919	0.9762	6.69e-86
3	3n3a:C	131	127	0.5354	0.5191	0.5354	1.27e-46	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	4bmo:B	118	114	0.3465	0.3729	0.3860	2.31e-20	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
5	1rlj:A	135	126	0.3701	0.3481	0.3730	1.42e-16
6	4n82:B	153	147	0.3465	0.2876	0.2993	1.63e-11	4n82:A
7	8g64:A	169	72	0.1732	0.1302	0.3056	0.005
8	8bon:B	1070	56	0.1496	0.0178	0.3393	1.1	8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A
9	8xus:B	1063	56	0.1496	0.0179	0.3393	1.1	8if2:B
10	8h3m:C	930	56	0.1496	0.0204	0.3393	1.2
11	1cen:A	334	25	0.1024	0.0389	0.5200	1.3
12	3qnm:A	231	128	0.2441	0.1342	0.2422	1.4
13	4fbg:A	399	27	0.0787	0.0251	0.3704	3.9	4fbg:E, 4fbg:G, 4fbg:H, 4fbg:I, 4fbg:K, 4fbg:M, 4fbg:P
14	5jca:L	471	44	0.1181	0.0318	0.3409	5.0	5jfc:L
15	5vj7:A	462	44	0.1181	0.0325	0.3409	5.4
16	6e12:B	212	59	0.1260	0.0755	0.2712	7.0
17	8jaf:A	320	30	0.0945	0.0375	0.4000	7.5	8j97:A, 8ja3:B, 8ja3:A
18	1tqy:A	421	41	0.1102	0.0333	0.3415	8.7	1tqy:C, 1tqy:E, 1tqy:G

[Back]