BioLiP

>protein
ELIVYFSTQSNNTHRFVQKLDAESIRIPIDEEERIKVDEDYVLIVPTYSGGAVPKQVIHFLNDPDNRKHCLGVISSGNTN
FGDSFAIAGPVISYKLKVPLLYQFELIGTKEDVEEVNRIISET

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mmp:E	139	135	1.0000	0.8849	0.9111	1.23e-84	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
2	7mmq:G	124	123	0.9837	0.9758	0.9837	2.98e-84
3	3n3a:C	131	124	0.5447	0.5115	0.5403	1.24e-45	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	4bmo:B	118	113	0.3496	0.3644	0.3805	7.96e-21	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
5	1rlj:A	135	125	0.3821	0.3481	0.3760	4.11e-18
6	4n82:B	153	144	0.3496	0.2810	0.2986	1.24e-10	4n82:A
7	8g64:A	169	72	0.1870	0.1361	0.3194	0.045
8	5veg:B	149	47	0.1220	0.1007	0.3191	2.3	5veg:A, 5veg:C
9	2zy2:A	521	67	0.1545	0.0365	0.2836	2.9
10	4fbg:A	399	27	0.0813	0.0251	0.3704	3.7	4fbg:E, 4fbg:G, 4fbg:H, 4fbg:I, 4fbg:K, 4fbg:M, 4fbg:P
11	1rxq:D	169	49	0.1138	0.0828	0.2857	6.1
12	3c4q:A	393	34	0.1057	0.0331	0.3824	7.2	3c4q:B, 3c4v:A, 3c4v:B
13	8jaf:A	320	30	0.0976	0.0375	0.4000	7.6	8j97:A, 8ja3:B, 8ja3:A
14	1tqy:A	421	41	0.1138	0.0333	0.3415	8.1	1tqy:C, 1tqy:E, 1tqy:G

[Back]