ELGKTLRRLRQGKQVSISSLADEHLSKSQISRFERGESEISCSRLLNLLDKLNITIDEFVSTHHTHFFTLLSRVRKYYAE
KNVAKLLKLLEDYAHKDYESTMIKAILSSIEPTVEPSEEEVTRLTDYLFSVEQWGYYEIILLGNCSRFINYNTLFLLTKE
MVTSFAYSEQNKTNKTLVTQLSINCLIISIDYSYFDHSHYLIEKIEFLLRDELNFYEKTVFLYVHGYYKLKQGQVSGKDD
MRQALQIFKYLGEDALYYSYKEHYRKEV
The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6w1a:A | 274 | 271 | 1.0000 | 0.9781 | 0.9889 | 0.0 | 6w1a:B, 4yv9:A, 4yv9:B, 4yv9:C, 4yv9:D |
2 | 6w1f:A | 280 | 276 | 0.5634 | 0.5393 | 0.5471 | 5.62e-102 | 7ji0:A, 7ji0:B, 6w1f:B |
3 | 6dql:A | 227 | 225 | 0.2276 | 0.2687 | 0.2711 | 1.16e-09 | |
4 | 4ryk:A | 295 | 275 | 0.2164 | 0.1966 | 0.2109 | 0.004 | |
5 | 8p7e:A | 309 | 28 | 0.0522 | 0.0453 | 0.5000 | 0.047 | 8p7e:B, 8p8f:A, 8p8f:B |
6 | 1ky8:A | 499 | 28 | 0.0448 | 0.0240 | 0.4286 | 5.3 | 1uxn:A, 1uxp:A, 1uxq:A, 1uxr:A, 1uxt:A, 1uxu:A, 1uxv:A |
7 | 8e56:F | 973 | 58 | 0.0560 | 0.0154 | 0.2586 | 6.0 | 8e57:F, 8e58:F, 8eog:D, 8fd7:D, 5gjw:F, 6jp5:F, 6jpa:F, 6jpb:F, 7vfs:B, 7vfu:B, 7vfv:B, 7vfw:B, 7xlq:D, 7yg5:D |
8 | 6zpi:C | 332 | 54 | 0.0560 | 0.0452 | 0.2778 | 7.3 | 4bn2:A, 4bn2:B, 6zph:B |
9 | 5n1q:A | 549 | 53 | 0.0634 | 0.0310 | 0.3208 | 8.3 | 5n1q:D, 5n28:A, 5n28:D, 5n2a:A |