ELELVANFADIPLRLSQILKLKPGDVLPIEKPDRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINPILNSLNEAMQDIDL
IMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLS
R
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yxb:B | 172 | 161 | 0.9814 | 0.9186 | 0.9814 | 6.40e-108 | 4yxb:A |
2 | 6seh:C | 252 | 74 | 0.1304 | 0.0833 | 0.2838 | 1.1 | 6seh:A |
3 | 8w7g:A | 390 | 59 | 0.1180 | 0.0487 | 0.3220 | 3.6 | |
4 | 2z36:B | 404 | 62 | 0.1429 | 0.0569 | 0.3710 | 5.6 | 2z36:A |
5 | 6kua:A | 163 | 88 | 0.1491 | 0.1472 | 0.2727 | 7.3 | |
6 | 6eg0:B | 309 | 80 | 0.1366 | 0.0712 | 0.2750 | 7.4 | 6nrw:B |
7 | 8qhp:A | 410 | 40 | 0.0870 | 0.0341 | 0.3500 | 7.4 | 8qhp:B |
8 | 8fux:A | 322 | 43 | 0.1118 | 0.0559 | 0.4186 | 9.1 | 8fuw:A, 8fux:B, 6mgc:A |