BioLiP

>protein
ELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVLRLEPLGVCSKDVWEFLELQI
EEIYPEEEEILKKALRDLKRGKKLKPEIKGKLSRLRLFPLSAEKVYTFAKVDAIIEEENGEFFIYLYEDFIDIDLNEEYW
ELYKKSRNLQKELKEAFERYESIRKVLDIRRRNLRKVLEKIVERQKDFLTGKGSLKPLTLREVSSEIGIHESTLSRIVNS
KYVKTPVGTYSLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSR
ERR

The query sequence (length=323) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5ui5:V	323	323	1.0000	1.0000	1.0000	0.0	2o8k:A, 2o9l:A, 5ui5:I
2	7qv9:M	417	343	0.3065	0.2374	0.2886	1.74e-37	8f1i:M, 8f1j:M, 8f1k:M, 7qwp:M, 7qxi:M, 8re4:M, 8rea:M
3	8reb:M	350	334	0.2879	0.2657	0.2784	2.14e-31	8rec:M, 8red:M, 8ree:M
4	5nss:M	388	142	0.1610	0.1340	0.3662	1.60e-20	6gfw:M, 6gh5:M, 5nsr:M
5	5nss:M	388	73	0.0588	0.0490	0.2603	6.91e-04	6gfw:M, 6gh5:M, 5nsr:M
6	6gh6:M	315	133	0.1517	0.1556	0.3684	9.84e-20
7	6gh6:M	315	73	0.0588	0.0603	0.2603	5.45e-04
8	2f48:B	552	90	0.0867	0.0507	0.3111	1.8	2f48:A, 1kzh:A
9	1kzh:B	530	83	0.0805	0.0491	0.3133	2.2
10	7fe4:A	659	93	0.0805	0.0395	0.2796	3.1	7fe4:B, 7fe4:C, 8iuc:C, 8iuc:A, 8iuc:B
11	6skg:Af	242	35	0.0464	0.0620	0.4286	5.1	6skf:Af, 6th6:Af
12	7lq4:A	192	48	0.0495	0.0833	0.3333	6.4
13	4o1w:A	79	49	0.0495	0.2025	0.3265	6.5	4o1w:D, 4o1w:B, 4o1w:C, 4o1w:E, 4o1w:F
14	2j9d:B	103	90	0.0805	0.2524	0.2889	6.5	2j9d:H, 2j9d:K
15	7ukn:A	1059	120	0.0960	0.0293	0.2583	6.9
16	5mpf:B	202	26	0.0402	0.0644	0.5000	9.1	5mpf:A

[Back]