ELEDFEQGEKYLTLTVSKNDFKKMEVVGQFNLGFIIVTRKVDNKYDLFIVDQHASDEKYNFETLQAVTVFKSQKLIIPQP
VELSELVVLLPVFEKNGFKLKISRVKLLSLPTSKQTLFDLGDFNELIHLIKELRRDNIRCSKIRSMFAMRACRSSIMIGK
PLNKKTMTRVVHNLSELDKPWNCPHGRPTMRHLMELRDWSSFSKDYEI
The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4e4w:B | 213 | 211 | 1.0000 | 0.9765 | 0.9858 | 1.45e-151 | 4fmn:B, 4fmo:B |
2 | 6rmn:B | 222 | 218 | 0.2596 | 0.2432 | 0.2477 | 5.21e-10 | 6shx:B, 6sns:B, 6snv:B, 6snv:E |
3 | 3kdk:A | 186 | 188 | 0.2067 | 0.2312 | 0.2287 | 7.29e-05 | 3kdk:B |
4 | 8h1e:A | 102 | 38 | 0.0673 | 0.1373 | 0.3684 | 5.80e-04 | 8h1f:A, 8h1g:A, 5z41:A, 5z42:A |
5 | 8h1e:A | 102 | 57 | 0.1010 | 0.2059 | 0.3684 | 0.036 | 8h1f:A, 8h1g:A, 5z41:A, 5z42:A |
6 | 6ahr:J | 247 | 80 | 0.0962 | 0.0810 | 0.2500 | 2.8 | 6ahr:I, 6ahu:I, 6ahu:J |
7 | 5ufc:A | 240 | 114 | 0.1442 | 0.1250 | 0.2632 | 3.7 | 5ufc:B, 5ufc:C |
8 | 3nf4:A | 369 | 52 | 0.0962 | 0.0542 | 0.3846 | 4.6 | 3nf4:B |